CAZyme Information: AKAW_05733-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_05733-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	DF126460|CGC4	65153.67	4.8695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126460:82387-84263(-)

Full Sequence      

MTSPPSTPLEADYVIIGGGTSGLVLAARLSENDSSRSVIVLEAGKNLTDDPRVQTPALWT
TLMGYEADWQFQSTPQAALNNRVIRETQGRVLGGSSAINGQAFIAPTKAGIDAWDKLGAT
GWTWGNLAPYYKKATTLQLPDEVTRDHIGVSWVDPEVNGNSGPIKVSFPAVKESPLAKAW
VDTFQEMGYGCTADPFSGVSTGGYSNLSSVDYEQKQRSYAATGYGLPAMERRNVRIITEA
TVQRIVFSTEESGATATGAEARIDGQIVTIKARKEVILTAGALNTPKLLELSGIGNRQIL
DQYSIPVIVENQNVGENLQDHLMTGISFEVKPGIATGDPLLRQEPEAIKTAFQLYSEQKA
GPMTIGGVQSSAYMPLMAFLGQPEAKLAYFDSFPPDLSERDQVIRDIYAQENEPTCQMFM
FLAQANLHDSGKSFVGQKLLPGNFLSLGIIQTLPFSRGAVHIASSDPTVSPIIDPRYFSN
PLDIDLMARNLLSLERLDSVKPIADYLVEGGRRNHPDAFLTDLESAKKYLRDTATTSYHS
SGTAAMLPREKGGVVDENLRVYGTKNLRVCDASIFPLVTAANPMSTVYAVAERAADIIKG
AQ

Enzyme Prediction     

No EC number prediction in AKAW_05733-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	599	1.6e-178	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.35e-107	6	600	1	533	choline dehydrogenase; Validated
225186	BetA	2.31e-106	9	602	6	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.72e-41	454	594	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.80e-34	77	322	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.79e-32	12	587	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02826.1|AA3_2	0.0	1	602	1	602
BCS14479.1|AA3_2	0.0	1	602	1	602
QDL52568.1|AA3_2	0.0	8	602	9	603
CAK46356.1|AA3_2	0.0	1	602	1	602
QSS49637.1|AA3_2	2.57e-265	3	599	2	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.86e-86	12	599	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.05e-67	13	599	8	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	7.95e-67	10	598	35	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	2.13e-66	10	602	1	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.07e-65	10	602	2	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.07e-103	12	598	15	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	7.38e-96	12	599	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	7.38e-96	12	599	15	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	5.10e-95	12	600	48	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.10e-95	12	600	48	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000008

TMHMM  Annotations     

There is no transmembrane helices in AKAW_05733-t41_1-p1.