CAZyme Information: AKAW_05592-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_05592-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	DF126459|CGC2	39100.99	4.8862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126459:614885-616022(+)

Full Sequence      

MSGLLGSRSWWLPSPGSRGFCYLFVYLAALFTLTPVVHAAVAVEPGAFGQLSQLANNPPF
PLATTNEDSETWSPVTNSMQLGEGKEEQDALQMMTFMNDATKTDPTSTETPCPKEKKGTT
RGGIESGSGSGRKTLPSSWWAPYTGTAPSEPQAHGELQHQATLGQPPTSGGYAPDVSPDF
DRHHFAVWGRVAAIDKDLIYDVLSAHQADLMLLMLGFNDMAWFQSDASGTLDSIRTLVIN
ARAANPNLKFAIANVPQRTLIPGREDIPFNTNIYNALLRNAVPEWSSAGSPIHLVELQEN
YDCGPDACPAGYDGLHPNTLGEYQIARAFSLTLVKVYGIGNSPLIIPDKIPERPPHLSFS
F

Enzyme Prediction     

No EC number prediction in AKAW_05592-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	176	330	1.8e-34	0.7371134020618557

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.70e-42	181	333	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.33e-08	200	325	54	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.41e-07	183	329	39	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	8.33e-05	190	330	45	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238868	XynE_like	6.18e-04	201	333	68	204	SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	3.63e-201	1	361	23	395
BAE63679.1|CE0	2.95e-93	135	354	89	311
BAE60780.1|CE0	8.05e-93	139	354	15	222
UKZ09962.1|CE0	1.79e-68	142	354	551	769
SCG40251.1|CE0	1.89e-58	142	354	375	591

PDB Hits     

AKAW_05592-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

AKAW_05592-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.273797	0.726177	CS pos: 39-40. Pr: 0.7006

TMHMM  Annotations     

Start	End
20	42