CAZyme Information: AKAW_05438-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_05438-t41_1-p1
• CAZy Family: GH17
• CAZyme Description: FAD binding domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		61847.36	5.9613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126459:150234-152309(-)

Full Sequence      

MYCGTSLFATLILAVSGITSALDCKCSPSDPCWPSADEWTSLNQTVSGRLIRTVPAASVC
YPNEPNYNPAACTSVLGNWTTSKFHSSDPVSVDDPIWSNNSCNPIYPDGTSITGNVHAEQ
DGCSIGNYPVYVINATNASHIQAGLHFAKEWNLRLNIKNTGHGSERSINHGSLSIWTHHL
KKIEFHEHFQPHRSSEVGSSAQTGNLTTMAATLGAGVQDGELFAALAQHNATAVGGTNMD
VGVVGWATGGGHGLATGTYGMGADNIIEAEIVTPAGELVTANAFQHEDLFWAIRGGGGGT
YGVIVSVTVKAYPMPLVTMINLSLTAKNATSEHDWYRLVAKAHGYLAELQNNGFHGYYTM
SSSPQLNMNGALLLYNAKNGTAERLLRPFQNFLKTQEAIATSMVAPMMTLPFYDVVQMMP
VVESTGKTQGVRASRFIPRRAVMEDVELLADTFEVIMSRNNSVNGVSAPSISGTMTGSAT
PVDNALNTAWRDSVVHLIVQQSWNESLPSALAEQTIYNMTYGRGYALRQLAPDTGCYFNE
ANPFEPEWQSSFFGSHYPRLHAIKSTYDPEGLL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	125	572	6.9e-61	0.9606986899563319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.76e-17	129	282	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	3.78e-11	205	315	91	207	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	3.48e-08	536	572	1	37	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	4.97e-74	16	573	491	1043
QKD57322.1|CBM91|GH43_11	4.97e-74	16	573	491	1043
EGX49222.1|AA7|CBM1	1.68e-13	91	570	129	583
UQC87672.1|AA7	8.66e-11	129	317	70	240
UJO23499.1|AA7	3.46e-10	212	341	130	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	2.44e-69	24	572	28	551	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	3.09e-66	24	572	30	575	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
4DNS_A	8.83e-18	129	315	55	228	Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon],4DNS_B Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon]
7E2V_A	1.07e-17	124	341	78	284	Chain A, MaDA-3 [Morus alba],7E2V_B Chain B, MaDA-3 [Morus alba]
6JQH_A	1.63e-16	129	365	54	274	Chain A, MaDA [Morus alba],6JQH_B Chain B, MaDA [Morus alba]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AS41|A7056_ARTBC	3.19e-78	8	572	6	568	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|A0A0E0RTV6|ZEB1_GIBZE	3.00e-75	7	570	12	538	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	3.54e-75	21	569	26	542	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|S0DL65|APF9_GIBF5	2.04e-71	10	571	5	561	FAD-linked oxidoreductase apf9 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) OX=1279085 GN=apf9 PE=1 SV=1
sp|B3FWS5|HPM9_HYPSB	1.93e-70	17	572	54	605	FAD-linked oxidoreductase hmp9 OS=Hypomyces subiculosus OX=193393 GN=hpm9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999721	CS pos: 21-22. Pr: 0.9625

TMHMM  Annotations     

There is no transmembrane helices in AKAW_05438-t41_1-p1.