CAZyme Information: AKAW_05126-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_05126-t41_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: glucose-methanol-choline (gmc) oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		63216.19	5.3422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126458:185131-186960(+)

Full Sequence      

MASTDQTWEFIVVGGGPAGCALASRLARSARRPQVLLLEAGPRKDDPLLRVDGQRWQTFM
NGDLNWGYKTTPQEHCNGRQIDYSRGKVLGGSSAINFGVYTVGARDDYNQWAGLVGDDLF
RWERMQARFRQLETFNGAIVDPKHSKYATPNTSDHGSQGGLKVGYAAEWEQDLPLMMDVF
EQAGLTRNPDHNSGDPIGMALVINSSHQGRRVTATDLLDGAPSNLTIITETPALKLVLQG
IKAVGVETTGARYFASKEVILTTGSLDTPKILMHSGLGPADQLQQFGIPVIKDIPAVGQG
LRDHFFAPLCFQRNPTTNDRDAFFGNPAAMESALEQWSKDGTGPWARHSCQIGAGWLKSD
RLVASEEFKALPPTVQDFLQRDTVPHYEFMTHFPLHLISPEPFKDYSYVCMLVFLMNEQS
SGEVRLQSANPEDPLLFDPKFLSHPFDRRACIEIYRHALEVTKHESFQKDTVSALIAPPS
DSDEDILEFWKNTLGSSWHMTGTTKMGKSGDVDAVVDSRFRVFGVENLRIADMGVVPVLT
NNHTQATAYVTGLTCGDALAEEYGFDISEARL

Enzyme Prediction     

No EC number prediction in AKAW_05126-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	561	1.7e-150	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.72e-87	1	562	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.83e-85	3	547	1	519	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.67e-37	419	555	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.40e-30	5	552	53	569	Protein HOTHEAD
366272	GMC_oxred_N	3.26e-22	76	304	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99292.1|AA3_2	0.0	1	572	1	572
BCS11595.1|AA3_2	0.0	1	572	1	572
CAK46531.1|AA3_2	0.0	1	572	1	572
EAA62931.1|AA3_2	6.91e-272	3	572	2	575
UPL00845.1|AA3_2	1.10e-263	1	563	1	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.20e-58	8	563	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	1.07e-53	8	559	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	1.46e-53	8	552	2	554	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6YS1_AAA	1.96e-48	6	546	6	547	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
3Q9T_A	5.03e-48	2	563	1	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.45e-62	5	570	48	627	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	2.95e-62	1	549	39	583	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.52e-61	8	557	5	525	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	7.54e-61	5	559	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	1.94e-59	5	568	49	625	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000003

TMHMM  Annotations     

There is no transmembrane helices in AKAW_05126-t41_1-p1.