CAZyme Information: AKAW_04997-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_04997-t41_1-p1
• CAZy Family: GH135
• CAZyme Description: alpha-L-fucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		87993.10	5.2884

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126457:771808-774287(-)

Full Sequence      

MKVVNRIALAWQLAVTAAAVSQSKFVSLDSYFNNKAFGVYPGQTSFDALNQSYPDPSIIG
INGTYTSTHTGVVYNFPGYRGPVLPDNVVCEGQTIIVPREKYFSASMLVTSDVQLSTVSG
NVTYTYSDNSTLVSELRSLPWWAFLTINRGEIIFPYRYTHNDTNFNTSHIFEYTAALNPN
KTLHSITLPVTTNTTTGRLHIFSISLWESTAPSAQVQFVRPTQKWTESGNQIVEVTINNP
GTSCIAGTGVNLSLSMAGVQTLEPGNIKRLCPGDQKRVNIGINGTANGTATVVLNYTHSI
QHQTYPHTLSLGLTEWTSELSSLSQHESPEWFDDAKFGIMIHWGPYSVPGWGNSTPYESY
AEWFWWYTTHRAADKSDTYDYRLRTFGPDWNYDDSFPSFTASNFSPKAWVDLIAASGAKY
FVLTTKHHDGFALFDTKNTTNRSSLHYGPRRDLVSELFTASSLHHPFLKRGTYFSLPEWF
NPDFGPYGFAELPGNTSTSWPGIIARNPYTGLNEPYTGRIPVTDFITDVMVPQMSILAHK
YSTDIMWCDCGAANGTASFASEWFNSARADNRQVTINSRCGVAEVSDFDTPEYATFSSAQ
LRKWESNMGMDPYSYGFNRATGWQGYMNASTVVRDLVDMVSKNGNFLLDVGPRADGSIVE
REERELRRAGEWIRGHGEAVFGTRIWWVRSEGVGVRVGSSHGAEMEVRFTQTNEAFYLLF
LGEPGNKVFVDAPVPLLEGDRVVVVRGDGVEEREVEWEGSAAEGFTFTVPEGAWNGEEFC
WVLKVVYVA

Enzyme Prediction     

No EC number prediction in AKAW_04997-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	315	682	6.3e-88	0.9219653179190751

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	1.27e-93	322	733	13	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	1.01e-85	315	678	7	333	Alpha-L-fucosidase.
226195	AfuC	1.75e-37	342	711	1	357	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93111.1|GH29	0.0	1	789	1	789
BCS05767.1|GH29	0.0	1	789	1	789
QKX54848.1|GH29	0.0	7	789	11	797
CAK41610.1|GH29	0.0	256	789	1	531
QDS68271.1|GH29	0.0	19	789	28	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ODU_A	1.85e-60	322	786	14	447	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	2.14e-60	322	786	14	447	alpha-L-fucosidase [Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]
1HL8_A	3.54e-60	322	786	14	447	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
2WSP_A	1.78e-59	322	786	14	447	Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8],2WSP_B Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8]
7LJJ_A	4.05e-47	308	692	34	411	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17164|FUCO_RAT	1.31e-59	316	788	33	461	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
sp|Q2KIM0|FUCO_BOVIN	1.04e-58	316	788	40	467	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1
sp|Q60HF8|FUCO_MACFA	1.37e-57	313	788	36	467	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
sp|P04066|FUCO_HUMAN	2.48e-57	316	788	37	465	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
sp|Q99LJ1|FUCO_MOUSE	6.45e-57	309	788	16	451	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000884	0.999074	CS pos: 19-20. Pr: 0.9121

TMHMM  Annotations     

There is no transmembrane helices in AKAW_04997-t41_1-p1.