CAZyme Information: AKAW_04968-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_04968-t41_1-p1
• CAZy Family: GH135
• CAZyme Description: exopolygalacturonase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		47939.33	5.0062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126457:680914-682369(+)

Full Sequence      

MVILSASGLAILAGLSLAASAVPSLQKNGTTCTVIPLGNGQDDVPNILSAVDQCGQTSGG
RIVLPAPYTYRINQRMTTHLTDSRLEIGGTLLFSDNIDYWVNNSYRVDFQNQSSAWRITG
HDYVVDGGPYQGGVDGNGQLWYTWAKGGSNVFGRPMPVHVFQSTRATLRNLAIRQPQFWA
VLVDSSSHINLDNFYVNATNHDFSVSPEGEWVQNTDGIDTYRSDHITITNWIYQGGDDAV
AFKGNSTNIHVENVTVYGGPGIAFGSLGQYPDRTDIVENVTVRNVQVQPSYQRAMNSGVY
FKSWIGVNYGDPPNGGGGGHGYVRNVTVENLRLKDVQLPVYIDTCLSYLFSENITQYCDT
STYEFNDLHFKNISGNGLATVTDYPGKNISFAVSLLCSEKAPCTDLTFQNINIKLPANYT
GKDVLCENAEVQGLRCNT

Enzyme Prediction     

No EC number prediction in AKAW_04968-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	51	431	1.8e-74	0.9753846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	9.30e-27	128	431	57	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	8.96e-21	214	432	204	393	polygalacturonase/glycoside hydrolase family protein
177865	PLN02218	5.02e-20	106	431	140	420	polygalacturonase ADPG
215426	PLN02793	8.78e-19	38	422	62	400	Probable polygalacturonase
178580	PLN03003	1.02e-17	37	422	32	366	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93142.1|GH28	0.0	1	438	1	438
BCS05796.1|GH28	0.0	1	438	1	438
ABD14403.1|GH28	5.25e-312	5	438	5	438
ABD61566.1|GH28	1.06e-311	5	438	5	438
QRD93508.1|GH28	1.11e-260	4	438	3	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	5.73e-23	42	438	30	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1RMG_A	1.71e-09	31	413	20	338	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	3.32e-07	155	414	151	375	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2EQQ2|RGXA_ASPNG	9.32e-313	5	438	5	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	1.88e-312	5	438	5	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|B8NJB0|RGXA_ASPFN	1.97e-261	4	438	3	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	1.97e-261	4	438	3	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|A2QG68|RGXB_ASPNC	2.24e-78	22	436	16	415	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000419	0.999569	CS pos: 21-22. Pr: 0.6276

TMHMM  Annotations     

There is no transmembrane helices in AKAW_04968-t41_1-p1.