CAZyme Information: AKAW_04628-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_04628-t41_1-p1
• CAZy Family: GH128
• CAZyme Description: acetylxylan esterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		32699.28	4.7556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126456:646830-647873(+)

Full Sequence      

MLLSTHLLFVITTLVTSLLHPIAAHAVKRSGSLQQVTDFGDNPTNVGMYIYVPNNLASNP
GIVVAIHYCTGTGPGYYGDSPYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGN
SNSIANMVTWTISKYGADSSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVSAGCFY
SNTNQVDGWNSTCAQGDVITTPEHWASIAEAMYSGYSGSRPRMQIYHGSIDTTLYPQNYY
ETCKQWAGVFGYDYSAPEKTEANTPQTNYETTIWGDSLQGIFATGVGHTVPIHGDKDMEW
FGFA

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	45	233	4.2e-19	0.7533039647577092

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.69e-36	48	256	1	204	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	3.66e-22	17	291	19	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.33e-19	50	238	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	8.95e-08	48	175	382	508	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	3.04e-05	83	173	219	302	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02633.1|CE1	9.44e-229	1	304	1	304
BCS14300.1|CE1	9.44e-229	1	304	1	304
BAA13434.2|CE1|3.1.1.72	3.16e-227	1	304	1	304
CAA01634.1|CE1|3.1.1.72	3.40e-222	1	304	1	304
AMQ81177.1|CE1	5.82e-216	3	304	2	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	5.15e-211	30	304	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92194|AXE1_ASPAW	5.61e-228	1	304	1	304	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2
sp|Q96W96|AXE1_ASPFI	1.03e-216	3	304	2	303	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	1.72e-215	3	304	2	303	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|Q0C8Z1|AXE1_ASPTN	1.23e-171	5	304	9	311	Probable acetylxylan esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	6.67e-171	27	304	26	305	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000315	0.999668	CS pos: 24-25. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in AKAW_04628-t41_1-p1.