CAZyme Information: AKAW_04403-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_04403-t41_1-p1
• CAZy Family: GT8
• CAZyme Description: LysM domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	DF126455|CGC2	42570.04	4.7866

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126455:910473-911943(-)

Full Sequence      

MVTTNATYSTRNPITSYNQTITPIDTAWPPTKTHPGQPKDCDKWYLVAPGDTCRSIYQRH
GNSITMDELLEWNPDLKADCDYPIAGYWVCVGIKRPALTIIYPTTNDTVPDPTPWTPRPT
PTETSVYPPTKTQPGLAPSCSAFYEAQPSDTCDQILASNPMLKFPLLLEWNPALKSDCSG
ILPGYFYCIAAYNDTNRPAPPTVTNQPYPLKPGTAKNCTAWYKSDDGDTCDLIVEMFGTF
DKAQFVAWNPDIGVECYGLESGYYYCVADPSTPKTRTRPVITAMSFPTAHPRRQPGVTKD
CNKWWLVSIHDDCYDIMHFNGITMADLYTWNPALSGKRNCLEGLVPDTEVCVGVMSSSSS
TTAAPSSTVPDASFRTGLVTVIGGRD

Enzyme Prediction     

No EC number prediction in AKAW_04403-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.80e-09	43	89	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	3.85e-04	45	86	1	37	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02341.1|CBM50	5.04e-304	1	386	1	386
BCS14019.1|CBM50	5.04e-304	1	386	1	386
CAK42252.1|CBM50	2.35e-256	9	385	422	794
QMW40446.1|CBM50	2.50e-99	3	368	140	503
UDD56385.1|CBM50	2.50e-99	3	368	140	503

PDB Hits     

AKAW_04403-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	2.51e-25	129	355	144	374	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	4.03e-12	140	275	29	187	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	4.87e-11	140	267	268	406	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	9.23e-09	266	354	339	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4Q2|LYSM4_ARTBC	9.38e-06	41	96	310	363	LysM domain-containing protein ARB_03442 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03442 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.959637	0.040384

TMHMM  Annotations     

There is no transmembrane helices in AKAW_04403-t41_1-p1.