CAZyme Information: AKAW_04044-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_04044-t41_1-p1
• CAZy Family: GH105
• CAZyme Description: alpha-1,6-mannosyltransferase Och1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		31638.27	3.9987

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126454:919432-920637(+)

Full Sequence      

MSTIHSIPHKLWQKTGTKGLTSQAESWISTWTTLNPHLRHEILTETSSLAYVETNFRPIW
PEIADLYTSLSVPILRADLLRLLILYIDGGIWSDLDVSCEVPISQWPIPSTANVVVGIEF
DGWQFASWTVMSTAGNGHIYHAIEYVAGRLEGLARENNVTVGEVTMEMIPDVVDVTGPQA
ITVALLETISEEVGRGVGKEEIEGIGEGGVLLGDVLVLPQASFAALQGGMPQGQGEYLVS
HHYAGSWKNEVGGEEGVKEDDGGEEQDGEEEVVIVVEGDGDENEGKEERSE

Enzyme Prediction     

No EC number prediction in AKAW_04044-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	25	107	2e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.14e-15	7	135	82	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.29e-11	25	108	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40793.1|GT32	1.51e-167	3	260	99	356
BCS04855.1|GT32	1.43e-96	131	291	1	161
BCS16417.1|GT32	1.43e-96	131	291	1	161
BCS30122.1|GT32	1.01e-88	7	260	111	369
EAA62114.1|GT32	1.05e-87	6	256	111	366

PDB Hits     

AKAW_04044-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.27e-15	7	250	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.99e-10	7	250	99	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	6.98e-09	7	136	130	274	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.57e-08	7	107	96	200	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AKAW_04044-t41_1-p1.