CAZyme Information: AKAW_03962-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_03962-t41_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	DF126454|CGC3	52650.95	9.2741

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126454:648749-650365(+)

Full Sequence      

MAVVSDIKKALSPQWRHSNRVYAILEYNYIVFPITLALVFYSYREFVNAIGYWVKVSDDG
WNSSAIKHLVLYGAILLLQMPPFGNTLGLCLPIRSNKYANRPKIRRLGTLHVCLVTKGTN
VQTVLNSTRCWDVLTQRSHPSVRFHVVLDSADNEHFRRELPSYITIDEVPGAFSPKRAKF
KARALEFFRQKYNFTKEDWILHLDEESEIDERVMRTSLDFIEKGTADYGMGTIYYTSTGH
WDKAFTSAAEVMRVTEDYGRFQLPVRLFRRPFLGWVHGSWILINGAVENKVTWDTENVCE
DYWFAYHAAAQGFKFDWLHAIVREQPPCTFTDLWKQRRRWFTGIGSFDRFLVRAALLAGA
FGGIGSLIFPLIGVFGQRIAVPTWYREFIMFNDAAGIHAIVSACLLQDFSVIGLPWTSML
YHVVTTLLLWPVVHIVHIMALFSTMMSPAKGFAVINKT

Enzyme Prediction     

No EC number prediction in AKAW_03962-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	199	430	6.4e-20	0.9593908629441624

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.07e-15	199	375	1	177	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.75e-06	175	450	119	391	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133049	CESA_like_2	0.006	293	343	179	229	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS04949.1|GT2	0.0	1	458	12	445
BCS16511.1|GT2	7.35e-308	1	458	12	428
BCS25143.1|GT2	3.77e-163	7	457	3	451
QRC91692.1|GT2	1.23e-64	63	457	51	442
CAE7032892.1|GT2	1.33e-64	16	457	5	445

PDB Hits     

AKAW_03962-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8XAC4|BRE3_CAEBR	2.45e-23	144	344	130	330	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis briggsae OX=6238 GN=bre-3 PE=3 SV=1
sp|O01346|EGH_DROME	2.49e-23	146	344	132	330	Beta-1,4-mannosyltransferase egh OS=Drosophila melanogaster OX=7227 GN=egh PE=2 SV=1
sp|Q03562|BRE3_CAEEL	4.47e-23	144	344	130	330	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis elegans OX=6239 GN=bre-3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000009

TMHMM  Annotations     

Start	End
21	43
69	91
357	379
394	416
423	445