CAZyme Information: AKAW_03431-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_03431-t41_1-p1
• CAZy Family: CE2
• CAZyme Description: periplasmic beta-glucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		94069.75	5.0685

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126453:396217-399050(-)

Full Sequence      

MATTTMPPAPDLGFLLESLTLDEKLQLIAGQSQWRTAKIDRLGIPSLKISDGPSGARGEV
FGEGVPAAFLPSGVSLGATWDRDLLFEIAQLLADECKSKSTSVLLAPTICIHRHILGGRN
FESFSEDPFLTGKLAISYVQGLQSCGVGATPKHFVANDQETKRFKYNAKVPTRALREVYL
LPFQMVVREADPWCMMTAYNRVNGHYCDASKELLIDIARGEWGWDGLFMSDWGGTTSTIE
SINNGLDLEMPGPPSKRSREALDQPIREGKIGLDRVSQSASRLLRLLKKTGRFSDPTDDP
EVCIDNPEKRALLLRAASEGIVMLKNEDKALPICPAENINKLAILGPNAERIVAGGGGSS
YIKAPYWTSIQGSLKQAFKDSDTEILTAEGAKVNRYLPVCMIAKDPDTGASGAAIDWYNS
QDWTGSPAATTHIDDLYYMSFGTTPPEVHDPTSFFFRIRATIKPHTSGHHALSLASIGPA
ELYLNGRRLLEQSGDFEEKGSLFFTYGSEEAITSTDFVAGLEYQVEIRYQAHGRQHNPKL
NPLMDPMEDQFQGIRFGFEEADSSDRPAEAAVLASDCDAAIVVVGRDKEWESEGQDILSF
NLPGEQVRLIREVAAVCKRTIVVVQAGTPVNMEPWIHDVQAVLYTWYQGQELGNAAAAVI
CGIVNPSGRLPVTFPRRIEDCPAFSSFPGEANEIEYTEGLFVGYRWWDLLKIEPLFPLGF
GLSYNEFVITPGSINTLSLTSLASSLVATVHVTNNGGSNVPGRETVIAWFSQCNPTRLKR
PRKQICAFAKSRPLLPGQSDGIQLHIDPHAFGMFDPVRHEWVIDAHVELEIMVGTTASNA
TSVWRVTAANEIVWLR

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	251	1.2e-61	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.17e-63	13	384	32	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.77e-51	553	704	67	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	9.15e-38	15	727	56	636	Probable beta-xylosidase; Provisional
185053	PRK15098	5.23e-36	15	815	41	734	beta-glucosidase BglX.
395747	Glyco_hydro_3	2.46e-33	26	286	50	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07145.1|GH3	0.0	1	856	1	856
BCR94550.1|GH3	0.0	1	856	1	856
QRC98638.1|GH3	2.40e-216	15	842	68	881
QQK45361.1|GH3	2.02e-214	16	828	18	832
UQC77018.1|GH3	4.59e-211	16	831	33	850

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.68e-155	11	854	5	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.68e-151	11	854	5	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.13e-107	9	837	2	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.56e-97	1	847	1	662	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.39e-91	15	839	7	704	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.95e-175	15	841	14	831	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.64e-166	15	837	5	799	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	3.12e-158	11	839	12	820	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DFA8|BGLI_NEOFI	2.65e-156	16	835	10	818	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.73e-156	16	835	10	818	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AKAW_03431-t41_1-p1.