CAZyme Information: AKAW_03414-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_03414-t41_1-p1
• CAZy Family: CE16
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		64103.75	7.1597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126453:343470-345529(+)

Full Sequence      

MENSFDYIICGGGTSGCVVAGRLAENPHIRILLIEAGQHNKDLENVHMVGGWSNLLDSTT
DWNIVTPPTPNVNNRQVKLSRGKFLGGCSGCNGTLCIRGSKQDYDDWGLDGWSGKEFFKY
MQKAETFHTKPWFKASDQHHGNSGPLHVEPHDLAPISERIMDSFVSQGLPLDPDMFTTGE
TPHGCGHVPRSVYNGIRTTSGDFVTNGYHRNNVTIMTDTTVDKILFKKTPSGPKADGVSV
VTANGRRTLHAKREIIISSGSYCSPTILMRSGLGPKEELQKHNIECLVNLPGVGKNLMDH
LIVFMFYETEKPGLTTDHHVYHDDSFDKTYALWKEKKEGFLSTFPFGSFAFARLDERLKN
EPLWKNAPRQPGRDPMGLTPNQPNVELFTTECFGGPKQYDQFPIDLKYAFSIIAELFSPR
SRGSVTLKSKDPLEKPVVDCNYLADPLDLLVITEACRFANEIITKGAGTKDIVKGSWPPN
LTHHTYTKREQWIPYVKEHATTCYHAGGTCAMGPDGDTNAVLDNKLRVRGVTGLRVADCS
VMPTLNGGHTQMPAYGIGEKCADLVKETWVSQALNVAKL

Enzyme Prediction     

No EC number prediction in AKAW_03414-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	567	3e-164	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.97e-107	1	566	2	532	choline dehydrogenase; Validated
225186	BetA	2.11e-99	1	567	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.28e-40	419	561	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.26e-34	69	302	11	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.14e-27	2	541	53	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07163.1|AA3_2	0.0	1	579	1	579
CAK49001.1|AA3_2	0.0	1	579	1	566
UDD65288.1|AA3_2	0.0	2	574	6	579
QMW48130.1|AA3_2	0.0	2	574	6	579
QMW36070.1|AA3_2	0.0	2	574	6	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.35e-76	5	566	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.28e-76	5	566	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.59e-76	5	566	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3LJP_A	2.42e-63	2	566	11	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
5OC1_A	2.59e-63	5	566	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	6.62e-79	1	566	1	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.40e-76	4	575	6	543	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	1.19e-74	1	565	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	4.53e-74	1	565	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q2T6D0|BETA_BURTA	7.12e-74	5	567	6	534	Oxygen-dependent choline dehydrogenase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000007

TMHMM  Annotations     

There is no transmembrane helices in AKAW_03414-t41_1-p1.