CAZyme Information: AKAW_03223-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_03223-t41_1-p1
• CAZy Family: CBM63
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	DF126452|CGC6	71688.73	6.5769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126452:1261728-1263704(+)

Full Sequence      

MLSFWQLLQLLLATLPAVAINLTGYEYIVVGSGAGGGPLAARLALAGHSTLLLEAGTDQA
HNLNTSVPAYAALAAADDHLSWNFFIRHYADDAQQARDPKTVYTTPTGEQYVGLNPPSGS
IMKGILYTRASTLGGCTAHNALVAIYPHRSDWTYIANLTNDPSWLPDPMRKYYIRLENNH
YLSPDIPGHGYTGWLSTEHAPINLVLQDPQLLSLLLGAVFTQPRTILSNLISLLLGDVNS
PSPSRDSKPAYYQTPIATSSNVRNGAADFLRAVLSATNPDGTQKYPLTIRTNCHVTRVLF
DTTSHPPKATGVSFLDGPYLYRASPLSSPNTPRTPGTATATREVILSVGVFNTPQILQLS
GIGPADLLQKHNIPVLVNLPGVGANLQDHYETSVVVEAPFPFRILNGCTFNYTSDPCLIR
WLNPKGLHKDRGIYSSAGFTSTLLHHTPFPNTSTTPNTNEDNNNDDYNTTIYGGLVNFRG
YFPGFEVNITLTHHSFTWAIIQAHPSNRAGTVNISSSDPLDPPHILFNSFSDPDSEKDLF
ALVDAIRVARKALKRQLIPTWETLPGKEVRGYEELRQYVLDTSWGHHAVGSCRIGRGERD
DDDDEGAVVDGKFRVRGVRGLRVVDASVFPRAQGTFPVLGVYMLAEKAVGDILGDDGG

Enzyme Prediction     

No EC number prediction in AKAW_03223-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	653	2.5e-91	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.59e-61	25	657	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.37e-54	25	654	6	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.12e-28	510	648	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.54e-27	25	644	56	568	Protein HOTHEAD
366272	GMC_oxred_N	7.88e-14	261	391	124	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15218.1|AA3	0.0	1	658	1	658
BCS03593.1|AA3	0.0	1	658	1	636
QMW33146.1|AA3	1.78e-256	6	655	5	644
QRD84722.1|AA3	1.78e-256	6	655	5	644
QMW45179.1|AA3	1.78e-256	6	655	5	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	3.62e-37	25	647	14	521	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.62e-37	25	647	14	521	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	8.98e-37	25	647	14	521	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YS2_AAA	2.80e-26	25	654	8	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	3.73e-26	25	654	8	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7FKL6|BETA_YERP3	5.22e-37	25	654	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	5.22e-37	25	654	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	9.56e-37	25	654	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	9.56e-37	25	654	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	2.37e-36	25	654	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.045656	0.954298	CS pos: 19-20. Pr: 0.8933

TMHMM  Annotations     

There is no transmembrane helices in AKAW_03223-t41_1-p1.