CAZyme Information: AKAW_02716-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_02716-t41_1-p1
• CAZy Family: CBM21
• CAZyme Description: cellobiose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550		58829.48	6.5907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126451:1336973-1338704(+)

Full Sequence      

MKSFLLAGLIATGSALGAVASPRVHASPRGSSYDYIIVGGGPSGIITAERLIEANKTVLL
LERGYGPTVATGSNETLVWNKTLTAVDLPGLSADIGALPQWEEYLCSDVAGYAGCVLGGG
VTLNYMVFVHPPDRDFNDKWPKGWKWDDVKPAADRLYERNPGTLLPSADGKRYDQGLYTV
LSNFFNKIGWKSVDMSAEPNEKHEVYSYPAWNIKDQMRAGPVRTYLPLAEKSKNFNLRLG
TKVLRLLRAGSQVTGVEVENSFGRRENITLGSNGRVVLSAGALSTPRILFNSGIGPSSQI
EIAQQSGVIVPPKKDWINLPVGIGAKDHPIFSIILKTNGTSYGLPDYDAIVNGSDVSDIS
LYAQGSGLLTQGKHRMIFFTSNVVDGQTRYYQGSCAPSGTNEVTITAYMTHGLTSSGVLG
LDTDGSTVWDKSPYLTTAGDRAAATAFLQQFVGELTAPSTGFQLETYTNVSAILGSVSPG
MHYTTSAKIGTDDGRYNNGTSVVDLNTKVYGTNNLFIVDGSIHPDLPTGNIQATIMVVAE
AAVARILALH

Enzyme Prediction     

No EC number prediction in AKAW_02716-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	549	1.2e-197	0.9890510948905109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.50e-41	26	550	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	5.82e-37	34	542	2	482	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.42e-18	32	547	5	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.33e-17	113	330	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.37e-14	434	542	24	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
GAA84602.1|AA3_1	0.0	1	550	1	550
BCR93747.1|AA3_1	0.0	1	550	1	550
BCS06374.1|AA3_1	0.0	1	550	1	550
CAK44335.1|AA3_1	0.0	1	550	1	550
BCS29639.1|AA3_1	1.41e-277	7	548	10	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KDG_A	2.21e-94	22	549	1	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	2.10e-93	33	549	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI7_A	2.49e-93	28	548	225	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	3.05e-90	28	549	3	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	4.28e-88	28	549	225	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.86e-91	12	549	218	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	9.86e-23	33	547	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.19e-22	31	540	39	601	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q8D3K2|BETA_VIBVU	1.76e-22	33	547	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|P46371|YTH2_RHOER	4.10e-20	34	547	8	490	Uncharacterized GMC-type oxidoreductase in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001850	0.998136	CS pos: 26-27. Pr: 0.9357

TMHMM  Annotations     

There is no transmembrane helices in AKAW_02716-t41_1-p1.