CAZyme Information: AKAW_02485-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_02485-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: pectin methylesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		43374.12	4.8670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126451:601175-602424(+)

Full Sequence      

MLLHGLLLALQAILASSAAITSPSSNHLSTAAREKCQTTLQCPPGTIIVSNTNAHPDISN
FTTLQAAINALPNDNSSQTILLLSGSYNEQVNITRAGPITLLGQQPDRAALTDPARNTVN
LTFAGANSDSSGNIDNVWFSVMVVAPTLDASLTGSGTTGYPVPADTPFGNTNFRVYNIDF
RNTYAPYSAGPAHAISFSRSNGGFYYCGFYSYQDTIYIGKLGSAYMYKSILAGQTDFLYG
FGTLFIQSSQIILRSCGGGITAWKGTNTTVRNNYGVYIHDSTINAANSSIAEQIQGSCAL
GRPWNSLHRSIFANTYEDGSIEPSGYINWEDRWSKNETLMAEYRAYGPGFNLTGREESEM
SVLLSSSEEERYRDPKRVFLFEDGREGNVAWIDWDVVSS

Enzyme Prediction     

No EC number prediction in AKAW_02485-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	58	372	5.6e-58	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	9.38e-27	54	355	10	275	pectinesterase
215535	PLN02990	4.13e-25	54	355	264	531	Probable pectinesterase/pectinesterase inhibitor
215367	PLN02682	1.72e-23	43	355	67	340	pectinesterase family protein
178051	PLN02432	2.92e-23	60	368	22	276	putative pectinesterase
395871	Pectinesterase	3.48e-22	60	372	11	289	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06612.1|CE8	3.97e-294	1	399	1	399
BCR94001.1|CE8	3.97e-294	1	399	1	399
CAK44519.1|CE8	2.85e-282	1	399	1	397
BAE63594.1|CE8	1.39e-166	5	396	5	385
UDD62592.1|CE8	1.39e-166	5	396	5	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.23e-21	61	367	19	284	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.05e-21	61	367	19	284	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	3.97e-09	47	355	1	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	6.01e-08	57	349	14	310	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	3.31e-06	57	349	14	310	Chain A, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QK82|PMEA_ASPNC	3.65e-21	10	367	7	312	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q9ZQA3|PME15_ARATH	2.56e-19	60	349	100	352	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
sp|O22256|PME20_ARATH	9.13e-19	60	355	255	518	Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana OX=3702 GN=PME20 PE=2 SV=2
sp|Q8RXK7|PME41_ARATH	4.04e-18	60	355	268	531	Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana OX=3702 GN=PME41 PE=2 SV=2
sp|Q9LVQ0|PME31_ARATH	9.97e-18	61	349	17	269	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999707	CS pos: 18-19. Pr: 0.9591

TMHMM  Annotations     

There is no transmembrane helices in AKAW_02485-t41_1-p1.