CAZyme Information: AKAW_01596-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_01596-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: class V chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42114.54	8.2916

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126449:1028019-1029415(+)

Full Sequence      

MFSGSSLFPHWRRKAAERSSNSSYEVPFFLNAAYYPNWRIYRKQPPSALRLGFISHIFYA
PYTETVVNQPAFFVHRVKEDGTVYLSDEWADAQMPVDGTNGCLRAFAQLKPQYSKMKLIL
SVGGGGKGSENFAQVARSQSRTETFARSARALVDQFGLDGIDVDWEYPSDPQEGSDYIRL
LARLREVLPAPRYVLASCLPAGPWALRNIDLSKAQLYLDLINIMAYDFSGPWENQSGHQA
QLFSKHPAAISCQNSISYILNQGVDPKKLLLGIPAYGRSFLGSSGVGQRYVGCGGEDGVF
DYSQLPRPGAKEHHDSSLGAAYCVGGDGGFVTYDTPQTVQQKAKFVTKMKLGGLFYWHIG
GDARGPRSLIETGYNTLHDM

Enzyme Prediction     

No EC number prediction in AKAW_01596-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	32	366	2.3e-67	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	5.59e-87	32	362	3	334	Glyco_18 domain.
119365	GH18_chitinase	7.14e-86	31	362	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	5.36e-79	32	362	3	307	Glycosyl hydrolases family 18.
225862	ChiA	1.23e-63	13	379	21	434	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	2.95e-63	34	359	4	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95707.1|GH18	6.96e-273	1	380	1	367
BCS08243.1|GH18	6.96e-273	1	380	1	367
CAK43705.1|GH18	1.51e-260	1	367	1	354
QRD87865.1|GH18	2.11e-231	7	380	7	369
UCK58594.1|GH18	2.11e-231	7	380	7	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	6.04e-66	9	377	4	376	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1D2K_A	1.25e-63	29	377	3	363	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	3.49e-63	29	377	3	363	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	6.91e-63	29	377	3	363	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
1WNO_A	1.48e-62	29	377	5	366	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92222|CHIB_EMEND	4.49e-65	29	373	4	358	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
sp|G5EAZ3|CHIB1_EMENI	4.49e-65	29	373	4	358	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	5.69e-63	19	377	22	398	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	1.58e-62	29	377	38	398	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|C5P230|CHI1_COCP7	3.12e-62	19	377	22	398	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999489	0.000544

TMHMM  Annotations     

There is no transmembrane helices in AKAW_01596-t41_1-p1.