CAZyme Information: AKAW_01560-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_01560-t41_1-p1
• CAZy Family: AA4
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	DF126449|CGC2	75556.53	5.2097

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126449:915822-917867(-)

Full Sequence      

MLYTEDNKLIFRFDDHLLWIQPWDDNALRVRATKLASMPTEDWALSPEIPSTEPKPTISI
EEHKDSSITNGKITAKVSQRGKITIYNHKGDKLLEEYARNRRDLKDPKCSALEVEARELR
PILGGDFHLTMRFESLDPKEKIYGMGQYQQPFLNLKGADIELAHRNSQASVPFALSSLGY
GFLWNNPAIGRAVLGTNTMSFEAYSTKVLDYWVVAGDSPAEIEEAYSKVTGYVPMMPEYG
LGFWQCKLRYWNQEQLLNVAREYKRRNIPLDLIVVDFFHWKHQGEWSFDPEFWPDPDAMI
KELQSLNVELMVSVWPTVENASTNYPEMLEKGLLIRHDRGLRVSMQCNGDITHFDATNPA
ARAYVWSKAKQNYYDKGIKVFWLDEAEPEYSVYDFDLYRYHAGSNLQIGNIFPKEYARGF
YEGMESAGQTNIVNLLRCAWAGSQKYGALVWSGDIASSWSSFRNQLAAGLNMGLAGIPWW
TTDIGGFHGGDPSDPAFRELFTRWFQWGAFCPVMRLHGDREPKPENRPTDSGSDNEIWSY
GEEIYEICKKYIGIREELRDYTRGLMKEAHEKGTPVMRTLFYEFPADKRAWEVETEYLFG
SKYLVVPVFEAGRRSIEVYLPAGASWKVWGQDDVIHEGGKVVQVECPIETMPVFVRV

Enzyme Prediction     

EC	3.2.1.177:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	211	656	1.6e-140	0.9859484777517564

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269877	GH31_xylosidase_XylS	0.0	231	555	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
224418	YicI	6.86e-163	85	656	104	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	4.23e-142	213	656	2	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	1.17e-65	231	656	1	421	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
269884	GH31_transferase_CtsZ	9.09e-64	234	561	4	325	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95669.1|GH31	0.0	1	657	1	657
BCS08207.1|GH31	0.0	1	657	1	657
CAK37022.1|GH31	0.0	1	657	1	655
KAB8212372.1|GH31	0.0	1	656	1	653
KAE8320666.1|GH31	0.0	1	656	1	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	9.45e-111	124	654	132	704	Xylosidase from Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
7KMP_A	3.97e-86	20	656	81	860	Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	7.13e-82	199	656	393	869	crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
5JOU_A	7.00e-73	200	656	366	839	Bacteroides ovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
6JR6_A	7.23e-66	140	656	156	683	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01336|YCR2_PSEVU	3.79e-211	2	523	4	528	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
sp|A2QTU5|XYLA_ASPNC	7.64e-110	124	654	150	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
sp|Q9P999|XYLS_SACS2	5.52e-108	127	656	100	617	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
sp|A7LXT0|GH31A_BACO1	3.56e-72	200	656	365	838	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
sp|Q5AW25|AGDD_EMENI	2.21e-56	130	656	168	691	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AKAW_01560-t41_1-p1.