CAZyme Information: AKAW_01274-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_01274-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: glucose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		61518.18	6.0941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126449:17355-19350(-)

Full Sequence      

MKAEETFDFIIVGAGVAGCVVASRISQSRPGLRILLIEAGVENDDRTSGAMGFVAGFGSD
IEWPHRSVPQERAFGGDTVCLTSGKLVGGGSGVNYQVFTRGPAVDYDQWADLVRDRRWSW
NGLLPYFKRVETWYPSVEMKERGCVTIDSHGDRGPIKVSHATNSGKPRNYPLREKSRRFH
ELLGRKQVDDMNSGQQLGYSEAFSSTYAGLRSFASSYPLGVNVTVWTNSTVERLIMTGRT
AEGAVIARSVGDKIERVHVRARREVILSAGHMDHPKSFFLGDGIGPAEELQRHNITPVVD
LPVGKNYADHPHIFTYWTIDQHNATLGDGEMETDQVHWLAGLPYDWMSFAPADAKTQELA
KQVLSSADRSRYLAEGKMQLENFIVYTAVDTSTRKKPLEGWPGKRVISLMHVLVDSVSRG
TLTLRSSDPADAPVLDPRLLASPIDRSAMYENVRETAHAIQAVEGLNAVEFGVDDFLRDN
WSDEAIDVRANRSGGSCFHYSGTCAMGEVVDTECRVYQVERLRVVDSGVFPLPLAAHYQA
PTYGVAEQAADMILSSVA

Enzyme Prediction     

No EC number prediction in AKAW_01274-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	555	5.3e-124	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.74e-78	3	555	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.55e-70	2	554	1	532	choline dehydrogenase; Validated
274888	Rv0697	2.08e-48	8	554	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.50e-30	418	549	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.39e-21	75	311	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10581.1|AA3_2	0.0	1	558	1	552
CAK47171.1|AA3_2	5.29e-262	51	558	1	428
BCR98132.1|AA3_2	5.39e-203	1	280	1	280
BCR98133.1|AA3_2	2.58e-159	331	558	1	228
QKX63105.1|AA3_2	2.26e-134	7	556	429	974

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.12e-45	6	553	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	2.94e-44	7	556	41	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	4.65e-44	7	553	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.72e-44	7	553	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	1.03e-43	7	553	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	3.84e-68	4	555	2	520	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.12e-46	1	556	1	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	3.06e-46	4	553	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q4ZM63|BETA_PSEU2	2.93e-45	1	553	1	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	3.22e-45	4	553	11	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.980010	0.019994

TMHMM  Annotations     

There is no transmembrane helices in AKAW_01274-t41_1-p1.