CAZyme Information: AKAW_00882-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_00882-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: glucose-methanol-choline (GMC) oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		56098.41	6.2222

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126448:747559-749228(-)

Full Sequence      

MTYPTADYIVIGGGTAGLVVANRLSEDPNVNVLVLEAGPDRSSDERVQNPAAWPTLSGSE
VDWQFKVVPQPGLNNRDQNYAAGRLLGGTSAINGLAFVPPAPAGIDAWEALGNPGWSWQS
LAPYFHRSFHVCPEAAPGNGPGAAASAATGPIEVTYPALAEPRNHTIIDAWNKTFADKGY
AFSDTLIPTPTTGTRPYTATITTTGVRSASTQYAASRPNLRILTNTTVERILFDTTSTTV
TTTGVLLHNDPSPITATKEVILAAGAFNTPKLFELSGIGSASRLSTHSIPCIIDNPSVGE
NLNSHLMAVLPVPIQPLPDTASPTPGIQAISFVRSGAEADLLSRHPPHPPLNNLLANPSE
PTACFFLSTLPNSMAILGLIPSYPLSRGSVHLSSSQPTDKPIIDPSYLSHPLDIKLMAAH
FKTLHALPDCSPFSGILGSAPGPSPETQDPGVVEETLRTSVVAAHHFCGTAIMAPREKGG
VVDTELRVHGTGNLRVVDASVFPTVTAANPMSTVYAVAERAAEIIRGRNKPACA

Enzyme Prediction     

No EC number prediction in AKAW_00882-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	526	3.1e-147	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.81e-98	4	532	6	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.52e-94	1	528	1	534	choline dehydrogenase; Validated
398739	GMC_oxred_C	9.54e-42	384	521	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.86e-24	5	528	55	580	Protein HOTHEAD
366272	GMC_oxred_N	1.56e-21	74	306	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12736.1|AA3_2	0.0	1	534	4	537
CAK96464.1|AA3_2	0.0	1	528	1	529
BCS00980.1|AA3_2	0.0	67	534	4	471
QRD83786.1|AA3_2	6.64e-144	6	526	4	530
QMW32332.1|AA3_2	6.64e-144	6	526	4	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.33e-70	1	532	1	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.87e-55	7	526	3	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.61e-54	7	526	4	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3LJP_A	1.79e-53	7	526	15	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	6.60e-53	7	526	15	527	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	9.36e-69	7	525	15	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	9.40e-66	7	527	48	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.40e-66	7	527	48	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A3B1EFP9|STR4_STRTC	1.29e-61	3	527	31	613	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|P9WMV5|Y1279_MYCTU	3.20e-61	6	526	5	527	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000008

TMHMM  Annotations     

There is no transmembrane helices in AKAW_00882-t41_1-p1.