CAZyme Information: AKAW_00278-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_00278-t41_1-p1
• CAZy Family: GT69
• CAZyme Description: glycosyl transferase, group 2 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		41234.04	6.4871

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126447:904698-906077(-)

Full Sequence      

MEPAIRRLAQTYVGHVRRVSLSFCTLYMALRLSCLICAPETNYWMWVVLIFEALWTSCVI
DYPQTAFRVLILDDGNSLELRQAVEELQHTWPNLLYYSRGTKPSQKVFAKAGNLNFGLFD
IQGGMDKPPELIAIFDSDFLPAPNFLRATLPHMLGDDSVGIVSSRQDYYNFPQGDPLDQS
LAMFFEVILPKMDEMGSSLATTSGCLMRRDLAVQVGGFPTLNEVEDITLSFILPAYGKRV
VYLTEMLQLGRVPTSLEGHVRQNRRWLTGLTEMIATPWAPSRESIPTPLRYSMAYFGIYW
VLSPLGQSIGCAIIAPALISRQALVPHHLLQVQIPSSLIAFGLVFLYEWLKAAAMGFRLS
VGLAVSQP

Enzyme Prediction     

No EC number prediction in AKAW_00278-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	3.70e-72	58	274	25	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	2.11e-21	60	359	80	374	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133059	CESA_CaSu_A2	3.45e-19	52	270	18	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133057	CESA_NdvC_like	2.19e-18	60	278	24	236	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
133045	CESA_like	9.38e-14	50	226	12	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47701.1|GT2	7.43e-208	1	360	1	389
BCS08720.1|GT2	1.53e-175	1	255	1	305
BCR96204.1|GT2	1.53e-175	1	255	1	305
QRD91169.1|GT2	1.25e-79	57	360	69	338
AMW91838.1|GT2	2.64e-73	57	359	56	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	7.20e-15	62	274	156	379	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.54e-15	62	274	168	391	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.54e-15	62	274	169	392	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q69L19|CSLC2_ORYSJ	6.19e-16	52	269	250	468	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC2 PE=2 SV=2
sp|Q7PC70|CSLC2_ORYSI	6.19e-16	52	269	250	468	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC2 PE=2 SV=1
sp|Q7XIF5|CSLA7_ORYSJ	9.89e-16	57	269	171	384	Probable glucomannan 4-beta-mannosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA7 PE=2 SV=1
sp|Q9SB75|CSLC5_ARATH	1.98e-15	58	269	250	462	Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1
sp|Q9ZQB9|CSLCC_ARATH	8.51e-15	58	269	264	476	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000011

TMHMM  Annotations     

Start	End
297	319
329	350