CAZyme Information: AGR95_109780.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_109780.mRNA-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		69040.49	6.2872

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_DU.Contig190:249848-251901(+)

Full Sequence      

MASALAFCIRDWFSAFVSHYMPTTPQSYLGWASGVHMYLSKSLFPLFNSIIIPTAADYVI
VGGGTAGLVLAARLSEDPGTSVVVLEAGTNHLEDPRVNIPALWTTLFGTDADWAFATVPQ
VTLGDRTINAAQGKMLGGSSGINGQAFVSASELVIDAWSKLGNEGWTWKNLHPYYKKSYT
LNLPDDETCEHLGLNWVEPSAHGSSGPIQVSFPGQLQNPLVKAWVELFKSIGYDVTADPY
SGASTGGFSSLAAVDPQTKTRSYAANTYGLAAMQRPGVHIVTDAFVKKVLLEGSKPDVHA
TGVEVDVKGQLVTVRANKEVIITAGALNTPKLLELSGIGNKKILQKYNIPVVVDNPNVGE
NLQDHLMSGISFEVVDGVVTGDPLLRQEPEATQSAMQMYSEHKAGPMTIGGVQSSALMPI
LEFAGVDGQKSQMRFFDKYLPTASTFQSTARDIFETHKAPTCDMFMFLAQANLHEANTSC
FVGTRLLPGNYLSLGVMQSIPFSRGHTHISSANPKDKQTIDPRYFSHPLDIEILAQNLLD
VERLHKNEALTKYLKKPNGRRNHSDSFLTDVESAKKYLRDTVTTAYHFSGTAAMLPEDQG
GVVNENLVVHGTLNLRVCDASIFPVIPPANLMATVYA

Enzyme Prediction     

No EC number prediction in AGR95_109780.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	56	637	7.8e-171	0.9735915492957746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.74e-110	56	635	6	520	choline dehydrogenase; Validated
225186	BetA	6.40e-93	56	637	8	524	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	5.11e-53	56	635	1	475	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.80e-33	122	366	13	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.13e-31	42	635	38	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS68114.1|AA3_2	0.0	52	637	6	591
QSS49637.1|AA3_2	0.0	52	637	6	591
QSS60310.1|AA3_2	0.0	52	637	6	591
CAK46356.1|AA3_2	4.23e-258	48	637	3	589
BCS02826.1|AA3_2	1.39e-256	53	637	8	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.48e-77	54	637	4	555	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	8.36e-66	58	637	8	573	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.50e-57	57	636	3	551	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.53e-57	57	636	4	552	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	1.31e-56	57	637	8	560	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	4.02e-94	52	637	10	599	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	4.02e-94	52	637	10	599	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.15e-92	51	637	9	607	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.90e-81	57	636	48	605	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.90e-81	57	636	48	605	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984080	0.015903

TMHMM  Annotations     

There is no transmembrane helices in AGR95_109780.mRNA-p1.