CAZyme Information: AGR95_108960.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_108960.mRNA-p1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	HISTO_LG.Contig392|CGC5	53315.29	6.5673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_LG.Contig392:478063-480290(-)

Full Sequence      

MLRLAVTVYRCGHSAILSHYHITVSSTLTISPLQRSMFVLSTPGDIILRTGDRWLPYAEY
GANQHIQLPNNLNFCAGQEVCRRELDPVSDKVSMPHSMTPKANATPSPFDNIRGELVIGD
EINISNLPASYVRLAKLSDGSVLAGFTTDEGGVKVIKTSKHTNGDQRFFPFGEITRGDWD
IGNIYLLEVAPSVVLGAFRNHTSVGPNLIHSRITVCKSTNGGKDWKFASQAFEMDGNLGA
WEPFMRLAENNPNEIQLTYSQEFAANEQRTMLVTSTDRGDTWSTPKAVSWKPKQRDGMTG
IAKTKDGNRDALVMVFETTDNVPFFNVKAVISYDDGASWCHRQDVQVAPRGKNAGAPQIA
SFADGSLVVVYMADEDIEGNWPHKANIKATFSAPPKNGKMCWSPPQVVKEADAFWPGALQ
FEDSTVMVTYDADGARAKPIRLNSLWSMAGQCFCGGYSVKTFAATLINPSDCDHRLKLGP
GPLEGE

Enzyme Prediction     

No EC number prediction in AGR95_108960.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	129	386	7.3e-52	0.8925081433224755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.37e-08	218	380	179	331	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.62e-07	209	370	43	215	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53313.1|GH93	1.21e-281	71	456	3	388
QSS58347.1|GH93	1.65e-253	104	456	14	367
QSS76105.1|GH93	7.78e-246	104	443	15	354
BCS24955.1|GH93	8.93e-105	106	443	26	365
EAA62412.1|GH93	7.61e-104	120	442	44	366

PDB Hits     

AGR95_108960.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

AGR95_108960.mRNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AGR95_108960.mRNA-p1.