CAZyme Information: AGR95_100490.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_100490.mRNA-p1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624		71862.32	8.4244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_ZT.Contig174:390012-391963(+)

Full Sequence      

MHVRTGMRTQRLVVLLAIVCLAGLSLTLLGHPAAAVKSGNKGKILTNNRFEPAKQQERPQ
PHQHQQQQNSPHERPTTADDFIGPSHPIAELFDDANRKFDDVRARQSKTLKDAVEEYRRR
YKMPPPPNFDVWFDFAQKRDVQLIDEFDTIYHCLLPFWGLQPKLIRARAMEVIGFDNGVI
AILIRDGKVSKITGGGESETWKRNALQNMLEPFVKYLPDMDLAFNVHDEPRVVVPHDDLQ
RLVVRAVDNALPKALGNASPKNSWSPRPKDMNKGDRVDEVRITQFNRYAHQPTWTVSRMS
CPVDSPARNLDGIVADNTTSYSYSKLGFLSNSTAFSDICLTPSLQYTFGFFDRPNAFNVV
HDLYPIFSQSKVSSFQDIIYPSPWYWAQKVPYDAAEDIEWDKKKEQMYWRGSTTGGFSRA
GSWRRHHRQLFVKRINGQDSAKVLERSTTPSGKNAWVLKDVARQKFKDIFNVKFSHIGQC
DPEDCKVQAEFFDVVEPATQHDAWNYKHLLDIDGNAFSGRYYAFMQSNSLVYKLALFREW
HDERLRAWVHYVPLSLRGDEHVEAVRYLAMEKEGQAIAQKLANQGKEWANSVLRNDDLEV
YFFRLLLEYGRIVDDNRESIGFSP

Enzyme Prediction     

No EC number prediction in AGR95_100490.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	342	613	1.3e-80	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.22e-16	361	611	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.00e-07	365	611	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS70518.1|GT90	0.0	1	624	1	624
QSS52524.1|GT90	0.0	7	624	1	618
QSS64625.1|GT90	0.0	1	624	125	743
BCR83603.1|GT90	1.19e-275	85	622	65	598
QKX56622.1|GT90	5.48e-271	7	623	298	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.46e-09	342	616	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	5.22e-09	365	613	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.46e-52	83	619	149	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	7.05e-11	358	613	157	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.80e-09	365	613	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.11e-08	342	616	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.47e-08	342	616	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001765	0.998171	CS pos: 35-36. Pr: 0.9409

TMHMM  Annotations     

Start	End
12	34