CAZyme Information: AGR95_088310.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_088310.mRNA-p1
• CAZy Family: GT21
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		47587.24	6.5632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_ZL.Contig1161:668514-670451(-)

Full Sequence      

MPTPTPTDANHLKSIQPVSCGWIDLFDSPSLIGWKSRLFGCRLKPDIQDIPKKRAEHSRA
GSTPICLPVEDILSFVVLGIATPMKQRLFQFEDMVLLALFLLLADSLVNASCECGFYMND
TKDYFTHVIYNNFSALAPSKKLSTNSAFTNDWAVQDWGIPPKGWVKPLGIDNAEDNVFLR
NGNLVLRQQGYSKAQALKKSKVSVASIASQRGDIIHGSFRVELKMENANGGSCGAFFWYH
DDKNEIDIEILSTEFKPDWFPVHYTTHPALDKNGQVIANATTVIPFRGDNLLNLFQRHRF
DWTKDELRFYQNSTLVHANAFQIPDAPGHAYLNVWADGGAWSGAPSTTDVFLTIKLIAIY
HNTSASDQGLDKVFNERCKKAGGPSNVTICLDTSVESGVVDPSSSGSAVVPLQLWILSLL
CVAFAIVVSAV

Enzyme Prediction     

No EC number prediction in AGR95_088310.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	197	360	1.4e-37	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.10e-43	143	360	4	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.15e-09	216	345	68	195	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	5.36e-04	171	351	34	223	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185687	GH16_beta_agarase	0.002	173	361	56	250	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS61966.1|GH16	1.95e-135	218	431	1	199
EAA58218.1|GH16_22	2.64e-32	96	364	4	292
CAE7022543.1|GH16_23	9.54e-31	99	408	13	328
BCS21543.1|GH16_22	1.17e-30	144	364	74	289
AIA62363.1|GH16_23	3.35e-29	99	391	14	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D6E_A	1.45e-06	216	344	59	182	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07980|GUB_BACAM	7.78e-07	129	344	12	220	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AGR95_088310.mRNA-p1.