CAZyme Information: AGR95_069290.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_069290.mRNA-p1
• CAZy Family: GH55|GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		49133.01	8.8635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_ZZ.Contig127:986573-988149(-)

Full Sequence      

PLSSLSVLFVFWKLLLLLAVVASPGPGYDTSTTLLPSTASASATDSSLLGVGTVIGGGSG
WSSSLLKLVRWDAIYFVSIAQRGYIFEQEWAFGYGYTKLLSFLSSVPDSNPDTLHVALTG
IGLSQTCHYLSVLSLHGLSRTVFGDGSSRALPLLAAALHVISPAGAFLSAPYGEPVFSFL
NFTGFFAYASALHDDRHGCVFARDVKFLVAGGLFATVTTVRSNGVLSGMLFAYDAVVGLA
AIVSSGVSLSKLHRMFFVVLGGSLILLGVVGPQYRAFMVYCRNGDMRRVWCDNTIPSVYT
FVQNHYWGSGTFLSYWKVSNLPLFCLAAPMLVIMGVSSWWPFQSPLDFDIRNKEPRKREE
VSQAEHRRTCLYRLAIPQAVLAALALTNSHVQIINRISSGYPLWYWYIAVCVLEYGNTFH
PVLKPRFLVQAMVLYSFIQGGLFASFLPPA

Enzyme Prediction     

No EC number prediction in AGR95_069290.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	8	450	3.2e-98	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.34e-30	68	450	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.20e-09	70	450	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49377.1|GT76	2.35e-314	1	450	23	477
QSS60603.1|GT76	3.46e-280	45	450	47	461
BCR82784.1|GT76	5.12e-131	1	450	20	465
QGA17664.1|GT76	1.07e-127	1	450	22	465
CAP97902.1|GT76	4.26e-126	1	450	23	450

PDB Hits     

AGR95_069290.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	3.45e-121	1	450	18	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.01e-110	1	450	29	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.21e-86	1	450	10	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.95e-81	1	450	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.82e-42	3	450	5	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001562	0.998426	CS pos: 24-25. Pr: 0.9065

TMHMM  Annotations     

Start	End
5	27
47	69
224	246
256	278
321	343
427	449