CAZyme Information: AGR95_063450.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_063450.mRNA-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		63996.28	7.1058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_FE.Contig19:316153-318108(-)

Full Sequence      

HPIDILMSRAKTNFDQWAAKAKSSQNLQDAVAEYQRRYKHPPPPGFDLWYKYATERSSVV
IDDYDQIYEDLLPFRALSPRTLRELTYALAADHSNDVATVSIRGGTTQIQEDILPTHRWM
IEGVAKMIGAVSQYLPDMDIAFNLNDECRVAVPWGDITTLHNSAKSHIHRSTGNFTGSWS
ENRASTWEPSESAKGAHGLFTDTSFQQVYDLVGRSVCPPSSKAGTSFVWDRRKICLDCAS
PHSLEQFLSNWTLASDICHQPDLASLSGFYLSPSAFKVSRPLLPVFSQSKISGFNDILYP
SSWNYVDKVIYEPTEEHPDVCYSEKQPTLFWRGTTSEGYSSAGQWKGMARQRMVHLANNH
TSNTVSILLPSSSSSSSKRHPTFYKYTNILASKIPATLDLPTSIFFAGQITRCSLLDCNF
QMAEFGLGPSTDFQEHWKYRFLMDADGAGFSGRFLPFLQSRALPFRTGLFRQWLDSRLTV
WYHFVPIDIRLHGLWSTLAYFSGARQKILMEPHIREGEFIAEEGRKWAEKALRKEDMEIY
MFRLLLEWARLTDDKRDQLGF

Enzyme Prediction     

No EC number prediction in AGR95_063450.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	261	552	5.6e-71	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	8.06e-10	281	551	29	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.06e-04	411	551	173	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS71693.1|GT90	0.0	1	561	412	1041
QSS56853.1|GT90	0.0	1	561	325	953
QVM13461.1|GT90	3.53e-252	1	561	401	963
UDD56220.1|GT90	6.13e-229	1	561	311	874
QMW40301.1|GT90	4.12e-228	1	561	428	991

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.44e-06	261	550	95	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.54e-29	1	557	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	8.21e-06	261	550	123	368	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AGR95_063450.mRNA-p1.