CAZyme Information: AGR95_062930.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_062930.mRNA-p1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	HISTO_EA.Contig33|CGC1	76328.91	9.4239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_EA.Contig33:349141-352041(+)

Full Sequence      

MLLSFLPSGSRARTLCCALILFASFATSSVLVREGDKQSLRDRNEFDYIIVGGGLTGLVA
AHRLSENLFASVLVIEYGIIDRSNKTLIPYLATSLNIPAMFDIRTAPEPGLEGNTYAVRA
GSVAGGGSTVNGMAYDRASAADYDSWEALGNRGWGWKGMFPYFRKSADFTPPKKAVVNKY
GYTYDESAYGRFGPLQVTFPDWQVPDQYKMADAFTELGVAHLREHAMGNAVGQFWAPATI
DAKTMTRSSSLTAYYDKASWRPNLKMLTEHKVTQLTFKGGSTTVSGVKAINRKTNKEVTF
RARKEVILAAGSLHTPQILQLSGIGPKCVVEAAGIKSRVDLPGVGSNLQDHPVAYLNWKV
TNSFPEPNIMMTNETFAAEALAEYQAHRTGPYTKAQSNTIAFLSLPMVTNNTEDMINSLK
QQVASKYLPGVYSRELIAGYEAQRAILAKQLGEGSVSALEFPFGGSGMVPNSVQKPLSRG
TVHINPDDPHGEPIVTYNAFTNPFDRAQLASFIAFTRRYFKTNALADMQPQEVSPGEDAQ
TEDEIIAKLAAGGPLSLSPSFAHPSSSCPMMPKNKGGCVGADLRVHGTRKLSIIDASILP
IIPSAHLQATIGEVSGRDDDDDRLSRIRMWRYSATRLPSISVFDKLGPPRYAAQIPNIIH
PENCDARAREKNGKPTHDLPRRAAKLILGSKRAEKPLSPR

Enzyme Prediction     

No EC number prediction in AGR95_062930.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	45	611	1.8e-161	0.971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.40e-69	44	613	4	525	choline dehydrogenase; Validated
225186	BetA	1.02e-67	44	611	6	522	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	6.36e-30	113	353	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.91e-30	476	611	1	136	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.62e-16	23	611	38	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75262.1|AA3_2	0.0	133	620	1	488
QSS59059.1|AA3_2	3.89e-291	210	700	1	474
QDS77604.1|AA3_2	3.41e-198	41	620	24	608
QRC99164.1|AA3_2	7.05e-162	18	631	7	636
QRC90410.1|AA3_2	2.41e-159	45	611	29	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	4.15e-113	15	620	4	636	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.99e-104	44	610	4	570	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	2.32e-64	46	620	6	562	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.57e-54	45	620	1	559	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.39e-54	45	611	2	551	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.96e-98	11	600	11	591	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	9.38e-72	22	611	24	604	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.38e-72	22	611	24	604	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|P0DO29|ERIK_HERER	9.63e-60	18	620	9	593	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	6.95e-58	46	620	14	606	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.758937	0.241060

TMHMM  Annotations     

There is no transmembrane helices in AGR95_062930.mRNA-p1.