CAZyme Information: AGR95_037270.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_037270.mRNA-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
934	HISTO_ZL.Contig1131|CGC2	101570.81	6.6772

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_ZL.Contig1131:555910-559173(+)

Full Sequence      

MLLPRVSSSSNLNSPLLQMGQLFVMGFDGTSVNSEIRSLIEDYHLGSVILTAKNLKSAEE
TTKLVYELQTIARDAGHPVPLLICLDQENGGVNTLFDEIYIRQFPSAMGMAATGSKSLAR
EVCKATAQELSAVGINWILGPVLDALTNARNQPLGVRSVGDDPQEVSAYGIEFMKGYQEA
GLVTCGKHFPSYGNLDYMGSQSDVPIITDTIEQLSVSALVPYRNAITHGIDSMMVGGCSM
ASAGMTVMHACLSEQVVDELLRKDLKFDGVVVSECLEMEALSYNIGVGGGTVMAMKAGCD
LILLCRSFSVQQEAINGLKLGVENGIISKSRIRESLRRVLDMKSRCTSWEKALNPPGISL
LSKMQPSHTSLSTRAYSSSLTVVRDKHNNIPLSSVLEPDEELLLLTPLIKPLPASAMLLS
MTTEASRAGLSADAASWERSASVMSGESVFKEFGRSLARQRNGRVLHTSYTANGVRPVHE
NLIDRASAVIVVTADANRNLYQNGFTKHVSLMCNSQFSPNGERRAKPVIVVAVSSPYDFA
TDPSIGTYICTYDFTETALQSLVKILYGELTPSGSLPGSLSRNQRLQQSRQHWLVENWNE
DRDAHALDTLLDIVREDGTQCQRSELASVTSTTFLLRNSDVEESHFVVRNSSTQALYGFC
STYYFKSTGTGVIGALIVDPSRRRMSIGHSLHNRAIRTLIQRPGIRSFQLGSRLPGIYHG
IPTGNPAERKRLRQWFANLGWNTALSRSVCSMMLRNLEDWSPPEGLTKVLQSSEVDYDLV
YGWEFADSVLDHVKTTSRVGVMEIYKRGLGGAPGSGIIRAKRREDGTILGSVVVYNSTAA
LAESMPALKDTRTIAGGISCPVISPSVGEYATLVQGLILLGIKQIRKQGARAAILDCVDA
DGNYDSLSAMGFSVLHSFEEVTCDASTWSMMAAS

Enzyme Prediction     

No EC number prediction in AGR95_037270.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	303	9.6e-52	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.20e-68	18	393	6	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.20e-64	20	340	7	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	8.92e-31	19	319	1	294	beta-hexosaminidase; Provisional
178629	PLN03080	1.58e-08	104	577	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	3.26e-08	103	343	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	18	934	8	924
QSS50503.1|GH3	0.0	108	934	1	827
QSS74235.1|GH3	0.0	108	934	1	827
BAE65506.1|GH3	0.0	18	934	47	961
QMW48185.1|GH3	0.0	18	934	18	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.95e-88	6	764	3	700	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.24e-62	18	581	16	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	9.16e-43	30	577	71	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.21e-42	30	577	45	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.76e-42	30	577	75	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	4.71e-42	30	577	71	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.56e-35	18	577	31	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.21e-28	30	577	49	593	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	5.69e-27	29	315	12	293	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q6LJ30|NAGZ_PHOPR	2.95e-26	22	318	6	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000089	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AGR95_037270.mRNA-p1.