CAZyme Information: AGR95_013520.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_013520.mRNA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
872		95432.26	6.1236

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_ZL.Contig1161:1888594-1891407(+)

Full Sequence      

MTHSMSSWLVAILIMMTLRRFFPGTQALPHCALHQDCHAYPNGTDGLDFGLTSQLPRTTL
PAAPASLSEGISITISIPLPIWPSTTTSQPPPSSVTSSAASSSPAPTAPSSSSSSTSTLV
PLPKPPPMNGQNAFEPVGTGPPPANIPSRGDHPVKPDHIVRKILFVFSNPDSNSDPHLQV
GSTGPLPTNKFFANFYLGSQTGPSFTHPYGVAWAKGKGPVTSYGLMVSNIEFNQLAFGPT
SQSIPGNPVQFYINPIGIQSMILSAAELGPSSVLVVSKPSAFSATILLSPYPGSTSHIAF
PLVQGMGFVTALYTKLQPMVQSGVFFRQFEQLGSPRPDLFKYRVMLEDRTEWLIYVMSAD
GTDPQLRLEDHSLIRGISGFSGTIQICKNPLGEEGEGIYDRSAGVYAVEVQLAGFVVADQ
QTGTYSFSWEKQGLDVSTTPLLMFALPHHCDSFDEKTKSRMTGLHLRTTTKGMATGIVGD
SWTMVETSLPISLGFAPWNAQSKKSPPLSEPVKEKLKMVAPTELNQDIHQQTYLDSMYFS
GKGFGKFSMLVYTVEKLAEDPSLAENAFRLLKEAFAKFVRNEQIWPLVYDTVWKGIVSSG
SYVTRDPGLDFGNTYYNDHHFHYGYFILSAAIMGTLDPSWIAGNKDWVNALVRDVSTPVP
DDPFFPCFRSFDWYNGHSWAKGLFESYDGKDEESSSEDALFAYALKLWGKAIGDASMEAR
GNLMLAVLARSLHAYFLLRSDNVNHPANFIANKVTGILFENKVDHTTYFGTNLEYIQGIH
MIPLTASSSYTRDQLFVKEEWEAMFAETACTPASKVQGGWQGILFANLALIDPFTSWEFF
SRDPFDYSKIDGGATRTWYLALAAGLGGGPRL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	182	861	1.9e-218	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	126	859	48	748	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	508	859	2	348	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.29e-152	152	500	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67487.1|GH81	0.0	1	872	1	852
QSS57493.1|GH81	0.0	1	872	1	852
QSS66079.1|GH81	0.0	1	872	1	854
QRD82801.1|GH81	0.0	129	868	192	909
QMW28320.1|GH81	0.0	129	868	192	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.27e-105	186	864	41	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.29e-105	186	864	66	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	5.20e-102	186	864	41	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.44e-28	538	833	340	627	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.89e-19	617	853	439	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.64e-311	128	865	188	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	5.30e-173	172	870	18	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.03e-163	169	866	420	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.16e-156	176	863	101	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.45e-155	183	866	79	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999769	CS pos: 27-28. Pr: 0.9586

TMHMM  Annotations     

There is no transmembrane helices in AGR95_013520.mRNA-p1.