CAZyme Information: AGR95_011000.mRNA-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: AGR95_011000.mRNA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		51573.51	8.9824

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG217B	11221	447094	0	11221

• Gene Location: location=HISTO_DA.Contig93:654249-656388(+)

Full Sequence      

MRDELSRRQGEEHTLGRLYACQQLHRPGLAMRGYDGHGTRTGSKRTAMAARSGSSPKYKP
PNWRKHGGVKRHIKHCNTQYASKQYKQKSQCWSSNESTPHSMSSPVALVPYAYSFFLYPY
GRTEGVLVLHLETSLFKLRSMLMAEATATSPVAEGAAHKKVWTTLITNCDYLPGLLTLDY
SLKKVRSRYPLVALYTDSFPPEGHAALQARNIPAKHIPYLLPAAHKDYSNDTRFYDCWSK
LAPFSLVEYDRVVQLDSDMLVFRNMDELMEMELDSSALKGEGSRVFAASHACVCNPLKKP
HYPKDWTPSNCALTTQHADPASAQTQGAPATAGLGVLNGGLQVVNPSTAIYEKILAVLQT
PSATSNYAFADQSLLSDLFPGRWVPLPYVYNALKTLRWEGVHSEIWRDEEVKNVHYILSP
KPWDEKGGEEGQGDETHRWWWKVNNERLEEEKKRGIR

Enzyme Prediction     

No EC number prediction in AGR95_011000.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	153	425	5.5e-43	0.9066147859922179

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	4.26e-74	161	447	2	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	2.40e-21	142	449	5	297	galactinol synthase
133037	GT8_A4GalT_like	5.86e-12	168	423	8	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	4.10e-11	170	427	9	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133064	GT8_GNT1	1.76e-08	166	268	7	111	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS61250.1|GT8	7.92e-247	107	456	16	397
QSS57188.1|GT8	2.76e-234	141	457	1	317
QSS72023.1|GT8	1.08e-224	141	457	1	317
AYG85441.1|GT8	5.09e-158	160	456	13	308
QKX53595.1|GT8	3.17e-156	160	456	14	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	1.54e-12	158	440	6	253	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
1ZCY_A	1.04e-06	160	424	24	241	Chain A, Glycogenin-1 [Oryctolagus cuniculus],1ZDG_A Chain A, Glycogenin-1 [Oryctolagus cuniculus]
3USQ_A	1.06e-06	160	424	24	241	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCT_A	1.87e-06	160	424	24	241	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V8Y_A	1.88e-06	160	424	24	241	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	6.44e-22	163	455	24	289	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q9XGN4|GOLS1_AJURE	3.76e-21	157	449	21	297	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O22693|GOLS4_ARATH	5.18e-21	150	449	13	298	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q4PSY4|GOLS7_ARATH	1.45e-19	153	449	13	295	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|Q9FXB2|GOLS2_ARATH	3.76e-19	149	449	10	297	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AGR95_011000.mRNA-p1.