CAZyme Information: AGR57_9612T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_9612T0-p1
• CAZy Family: GT59
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		66434.47	5.3883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC009:1486238-1489077(+)

Full Sequence      

METKLASVGDISNKTFDYVIIGGGTAGCVVAGRLSEDANVSVLVLEAGPPHLDEPILRKP
GAFLKPLLDAEYDYQYAAVPQAELRGQSVMFSRGRGLGGTSLINWMIWTVPQREEIEAIG
KLGNDGWNWENFHKYQRKVQSFHPPPFHHSDKSKRLYDSTAVGHEGPVPLIVARDCCGAE
TLWEQSLAKYGVEPISTSLNGQVAGSYKNVSNIDPTTQERVNAAAAYLTPALDKPNLKVL
TDAYVQKILTQNYGEGVTASGVEFEYDGSVHKVFARKEVILCAGTVKSPQILELSGIGDP
KILKPLGIDVKVDLPTVGTNVQEHVVMGINRWKLKEDQNIITSGMLEDPEQAEKLRLSLG
SQDAIQMVVNSLSFVPIQAASDRADALVRKQEEKHARNSGTYPPGLKEQHDVQLQLLADP
SVPDFEVLFFPFMFNFFPNPEPNKPYLNLLPILARPFSRGTIHIASADPKASPAIDPRYF
DEEIDLDLLVDAVKFARKLTQTEPLSNIIEREELPGPDVQTDEQIYEYVRSYAGSSWHTC
GSNSMLPRDKGGVVDSNFKVYGTHNLRVVDLSVLPLHTAVHPQATVYTLAEMACDIIRAR
RP

Enzyme Prediction     

No EC number prediction in AGR57_9612T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	599	2e-174	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.03e-100	11	602	1	536	choline dehydrogenase; Validated
225186	BetA	3.60e-100	12	602	4	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.90e-45	456	593	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.12e-29	12	600	52	580	Protein HOTHEAD
366272	GMC_oxred_N	5.27e-26	86	326	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96843.1|AA3_2	4.40e-136	5	598	6	577
VWP02516.1|AA3_2	1.10e-127	205	598	3	393
SJX61802.1|AA3_2	3.52e-116	16	598	18	603
CBQ71929.1|AA3_2	2.15e-114	16	598	18	603
QRW13145.1|AA3_2	5.08e-113	4	599	25	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.99e-87	11	598	1	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.10e-66	16	599	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6XUT_A	1.37e-66	11	599	12	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
3FIM_B	3.03e-66	16	599	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.89e-65	13	598	3	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	2.27e-92	10	597	41	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.27e-92	10	597	41	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	5.72e-75	7	602	5	621	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	8.16e-75	10	598	8	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	8.16e-75	10	598	8	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999980	0.000068

TMHMM  Annotations     

There is no transmembrane helices in AGR57_9612T0-p1.