CAZyme Information: AGR57_9594T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_9594T0-p1
• CAZy Family: GT57
• CAZyme Description: Class II peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		39300.06	4.0954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC009:1444920-1446516(+)

Full Sequence      

MALKQLAAAVALALSIQAAQGAAVKEKRATCSNGATVGDASCCAWFDVLDDIQQNLFNGA
QCGAEAHESIRLVFHDAIAISPALESQGKFGGGGADGSIILFDDIETNFHPNIGLDEIVN
LQKPFIQKHGVTPGDFIAFAGAVAMSNCPGAPQMNFFTGRAPATQAAPDGLVPEPFHTVD
QIISRVNDAGEFDELELVWMLSAHSVAAANDVDPTIQGLPFDSTPGVFDSQFFVETQLRG
TAFPGSGGNQGEVESPLPGEMRLQSDSSIARDSRTACEWQSFVNNQSKLVSDFQFIFLAL
TQLGQNPDAMTDCSDVIPISKPVPNNVPFSFFPAGKTMADVEQACAETPFPTLTTLPGPE
TSVQRIQPPPGA

Enzyme Prediction     

EC	1.11.1.14:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	45	306	2.2e-115	0.996078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	0.0	29	361	1	328	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
403189	Peroxidase_ext	1.32e-26	289	362	1	72	Fungal peroxidase extension region. This region is found as an extension to a haem peroxidase domain in some fungi. This region is about 80 amino acids in length and forms an extended structure on the surface of the peroxidase domain pfam00141.
173823	plant_peroxidase_like	1.21e-21	47	293	2	246	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.35e-19	48	285	1	187	Peroxidase.
173825	ascorbate_peroxidase	1.72e-07	104	304	60	249	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAA33737.1|AA2	6.81e-270	1	372	1	372
AAA33736.1|AA2	2.56e-267	1	372	1	371
BAG85349.1|AA2	3.24e-250	1	372	1	373
AAA53109.1|AA2	6.02e-248	1	372	1	372
CAA38178.1|AA2	1.22e-247	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1B82_A	1.18e-243	22	372	1	351	Chain A, PROTEIN (LIGNIN PEROXIDASE) [Phanerodontia chrysosporium],1B82_B Chain B, PROTEIN (LIGNIN PEROXIDASE) [Phanerodontia chrysosporium]
1B85_A	3.95e-242	22	372	1	351	Chain A, Ligninase H8 [Phanerodontia chrysosporium],1B85_B Chain B, Ligninase H8 [Phanerodontia chrysosporium]
1B80_A	7.96e-242	22	372	1	351	Chain A, PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8) [Phanerodontia chrysosporium],1B80_B Chain B, PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8) [Phanerodontia chrysosporium]
6ISS_A	3.24e-241	22	372	1	351	Chain A, Ligninase H8 [Phanerochaete chrysosporium RP-78],6ISS_G Chain G, Ligninase H8 [Phanerochaete chrysosporium RP-78]
6A6Q_A	2.66e-240	22	372	1	351	Chain A, Ligninase H8 [Phanerochaete chrysosporium RP-78]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50622|LIG6_PHACH	1.21e-270	1	372	1	372	Ligninase LG6 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG6 PE=2 SV=1
sp|P31838|LIGB_PHACH	2.16e-248	1	372	1	372	Ligninase B OS=Phanerodontia chrysosporium OX=2822231 GN=LIPB PE=1 SV=1
sp|P21764|LIG3_PHACH	4.36e-248	1	372	1	372	Ligninase LG3 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG3 PE=2 SV=1
sp|P06181|LIG8_PHACH	6.19e-248	1	372	1	372	Ligninase H8 OS=Phanerodontia chrysosporium OX=2822231 GN=LPOA PE=1 SV=1
sp|P31837|LIGA_PHACH	1.89e-242	1	372	1	372	Ligninase A OS=Phanerodontia chrysosporium OX=2822231 GN=LIPA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999741	CS pos: 21-22. Pr: 0.9713

TMHMM  Annotations     

There is no transmembrane helices in AGR57_9594T0-p1.