CAZyme Information: AGR57_9516T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_9516T0-p1
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866		98293.83	6.3443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC009:1283444-1286953(+)

Full Sequence      

MTSTIDPGTIGKPAPKRRHVRSLTGYLPEVDESGKEKWPRGEEKVWKAGIRGPDRDVPSI
TKSVVNHVHTSLARQAYNLDDFGAYQAAALSVRDNLIINWNATQLNYTRKSPKRAYYLSL
EFLMGRTFDNALLNLGLKKEYGEGMNQLGFNLEDLLEKERDAGLGNGGLGRLAACYLDSS
ASQELPVWGYGLRYKYGIFQQLISPDGSQLEAPDPWLEHDNPWELPRADVSYEVRFYGHA
ERLEDMKGIWSGGQEVLAVGYDTMIPGYDTKNTNNLRLWESKPKRGFDLQSFNAGDYERA
IESSNSAAAITSVLYPNDHTTFGKELRLKQQYFWTAASLADILRRFKNLDKPITEFPDYV
AIQLNDTHPTLAIPELMRILLDEEDVPWETAWNIVTNTFFFTNHTVLPEALEKWPVPLME
NLLPRHMQIIYDVNLLFLQAVEKKFPGDRDRLGRMSLIEEGFPKNVRMANLAVIGSRKVN
GVAELHSELLQQTILKDFVEFYGPSKFFNVTNGVTPRRWLDQCNPGLSDLIQQTLQVPKG
DFLKDLYKLEGLLKYVDNPSFQKKWAAVKQSNKERLANYVEATLGYKINTQAMFDVQIKR
LHEYKRQTMNIFGVIHRYLAIKEMTPEQRKKVNPKVVFFAGKAAPGYYIAKLTIRLIVNV
ARVINHDPDTKDLLSLFFLPDYSVSLAEILIPASDISQHISTAGTEASGTSNMKFCLNGG
LLLGTVDGANIEIAEEVGENNVFFFGHLTPAVEDLRYQHTYHPQPIEQKCPSLARVLHEI
SSGRFGDGGVYEPLLNTIRTGDYYLLTEDFDSYIQALALVDEAYQNRVEWIKKSISTTAK
MGKFSSDRAINDYAQECWNIESVKLL

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	145	861	8.1e-270	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	87	865	44	815	glycogen phosphorylase; Provisional
223136	GlgP	0.0	67	861	16	749	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	117	858	63	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	67	860	4	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	62	860	2	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP00170.1|GT35	0.0	1	862	1	844
QRW10328.1|GT35	0.0	4	864	13	880
QRV96004.1|GT35	0.0	4	864	13	880
QRV81529.1|GT35	0.0	4	864	13	879
CCA66496.1|GT35	0.0	1	865	1	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	18	863	2	878	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
1Z8D_A	3.20e-262	43	861	12	829	Chain A, Glycogen phosphorylase, muscle form [Homo sapiens]
2FFR_A	2.06e-261	49	861	6	817	Crystallographic studies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
2GJ4_A	7.99e-261	49	861	6	817	Structure of rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	8.26e-261	49	861	6	817	Structure of rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	18	863	25	901	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	5.33e-307	15	861	6	841	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	3.13e-284	32	864	89	911	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9XTL9|PYG_DROME	3.38e-264	56	861	24	829	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
sp|Q8CI94|PYGB_MOUSE	7.46e-263	42	861	11	829	Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AGR57_9516T0-p1.