CAZyme Information: AGR57_8180T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_8180T0-p1
• CAZy Family: GT2
• CAZyme Description: Glycosyltransferase Family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		47335.73	5.7962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC008:291078-292799(-)

Full Sequence      

MFDYDVVGPAFEAEYQKLLSGRAIHCVHTQKDLPALAAPRAVIIDIMSYPLKQIASKLSS
TVKVFCIGPSSVLGVYALSGASALQASGQTFIEEKIQEYMQKNGVSLREAANAVVKIPSD
EIITIPGFPKVYFYEANPQARTFEAPLGFIRYLAMQFLKECDAFISGSMECVEPEGVVEG
LSDFFARTSRKLYLLGPLLPMTKRSDAVEARQAAKSPEIASFLKTTLETRGERSMIYMSF
GTIFWTIKPEIVWTFLDVMIEKKIPFIMSHASPEAKVPDELQTKVKASGTGLLVPWAPQQ
AILEHPATGCFVTHAGFNSVVESIYAGVPMICWPFAAEQPLNAIQLTENLGVAYELLEVR
TGDGLRPIYRTGKAPAGTLDAVRAEAAAVLDKAFGADGEAKRAKVRELRETSLRLWAPGG
AAARAGEDLLDSLQ

Enzyme Prediction     

No EC number prediction in AGR57_8180T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	214	413	1.6e-29	0.3795811518324607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.02e-34	227	407	233	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
215465	PLN02863	3.41e-25	183	413	232	449	UDP-glucoronosyl/UDP-glucosyl transferase family protein
215112	PLN02167	9.60e-24	168	410	223	447	UDP-glycosyltransferase family protein
177813	PLN02152	1.44e-23	155	348	189	386	indole-3-acetate beta-glucosyltransferase
215127	PLN02210	5.55e-23	99	356	145	391	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP02307.1|GT1	7.06e-97	11	433	88	531
VWP02304.1|GT1	2.85e-90	10	433	88	497
VWO96367.1|GT1	6.88e-86	11	433	26	461
VWO96365.1|GT1	3.82e-85	11	433	90	525
ARE72247.1|GT1	5.09e-45	33	434	90	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ACV_A	2.64e-22	121	433	172	461	Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula],2ACV_B Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula]
2ACW_A	2.68e-22	121	433	172	461	Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula],2ACW_B Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula]
2C1X_A	1.76e-19	175	431	189	448	Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C1Z_A Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C9Z_A Structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera]
5NLM_A	3.52e-19	286	429	342	470	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]
6SU6_A	3.84e-19	286	429	363	491	Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU6_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU7_A Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_C Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_D Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1V0QSE8|ERIJ_HERER	9.05e-46	33	434	90	505	UDP-glycosyltransferase eriJ OS=Hericium erinaceus OX=91752 GN=eriJ PE=1 SV=1
sp|Q6WFW1|GLT3_CROSA	5.42e-23	124	349	171	406	Crocetin glucosyltransferase 3 OS=Crocus sativus OX=82528 GN=GLT3 PE=1 SV=1
sp|A0A2Z5CV93|U70G2_CROXC	1.42e-21	193	359	240	402	Myricetin 3-O-rhamnoside 1,2-glucosyltransferase UGT709G2 OS=Crocosmia x crocosmiiflora OX=1053288 GN=UGT709G2 PE=1 SV=1
sp|Q43641|UFOG_SOLME	6.64e-21	114	343	151	366	Anthocyanidin 3-O-glucosyltransferase OS=Solanum melongena OX=4111 GN=GT PE=2 SV=1
sp|G3FIN8|UGTK4_MANES	9.17e-21	125	362	187	441	Linamarin synthase 1 OS=Manihot esculenta OX=3983 GN=UGT85K4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AGR57_8180T0-p1.