CAZyme Information: AGR57_8104T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_8104T0-p1
• CAZy Family: GT2
• CAZyme Description: Glycoside Hydrolase Family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		94448.27	5.9327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC008:134342-137404(-)

Full Sequence      

MAPSDFAKANIDEVVEQLTTDEAILLTAGVGFWHTHGVPRLGVPALKVSDGPNGVRGNHF
FMSTPAKCLPSSTAMGATFDPELIEQIGRKLLAEEAKIKAASILLAPTCNIQRNPLGGRA
FESFSEDPFLSGMIAAAYVKGVQAGGIATAIKHFVGNDKENDRMAYDSIMSERALREIYL
MPFMLAEKYAQPWSYMTAYNRVNGTHVSENPYIIRDILRKEWGSNALVMSDWFGVYSIDH
AINAGLDLEMPGTNKWRTLDLMNRSIQSRKITARTVKERARKVLELTKKCAQEAPEVLDG
DGIERTKESEADSALMQSLAAQAIVLLKNDGALLPLKPKELKKVAIIGGNAKARVLSGGG
SAALKSSYFISPYDGIVEAIHAVDPNVEITYSEGARTYRTMPTLDYDLVTEDGKPGWTCT
WFSHESDESMTPLNQPIKTQYVDETRIFISTSYPENITKRWTFTLDGFLKPRDRDMLFEF
GLIASGRAKLFVDDQLVIDNWTKQRRGEYFFSCGSEEEYGRFPLKAGVAHKIHVVFCNVR
APADDDPNEAIMDANAGVQLGGAEVRDADELLDSAVQLASEADVAIAVVGLNADWESEGY
DRTTLALPGRTDELVAKVRAANPRTIVVTQSGSSIAMPWADDVPAIVHSWYLGNATGAAL
GDVLTGKVNPSGRLSLTFPKKLEDVPSHGHFHSEHGKVRYGEDLFVGYKHYHHRGIAPLF
PFGHGLSYTTFEYSDLTLSEPTFTNGDVSVTATVKVKNTGPVAGSEVVQLYVSLPTTSEL
THPPLMLKAFAKLRDIAPGQAATATLKLDKYAVSYWEERIARWVVESGEYVVRVGRSSAP
EDLSLKAKFILKKGFEWNGV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	251	5.7e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.01e-73	70	839	121	755	beta-glucosidase BglX.
224389	BglX	8.39e-67	20	382	40	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.28e-57	324	708	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.52e-38	40	286	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.61e-31	11	776	62	712	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDK64604.1|GH3	0.0	1	860	1	897
QDK64607.1|GH3	0.0	1	860	1	897
AAG59831.1|GH3|3.2.1.21	0.0	1	860	1	862
CDJ79822.1|GH3	0.0	1	859	1	859
AMK37826.1|GH3	0.0	1	860	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.12e-208	7	860	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.97e-203	7	860	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.84e-129	10	846	4	663	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.79e-108	15	838	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.97e-99	11	849	4	711	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	9.56e-228	10	860	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.98e-227	8	860	3	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.79e-227	8	860	3	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WU49|BGLI_ASPFU	3.82e-227	10	860	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.08e-226	10	860	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AGR57_8104T0-p1.