CAZyme Information: AGR57_8035T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_8035T0-p1
• CAZy Family: GT15
• CAZyme Description: Glycosyltransferase Family 24 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1583		175753.37	4.7388

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC007:2026153-2032108(+)

Full Sequence      

MRLYCLLSPLILSAVLAASPPVQVELRTSWASPPFLVELLETIAVEEPESFFPLLDRFTH
PDWSSLAQDKTEHQIYRDALQDALAAGYLSEPGELASFEATFALHSSVPRIEASYQYYLA
SQAARGADCGSWVDWYGEVVCDVNDLKRLAGVETIDAGEAVAGYNASSTVKLLPFDHVHP
SPSRTPDRPARTAILYASLTSPNFRDLHSFLYAASSGPAPHLEYVLRHVPPQVHHSSEER
TYLSGYGVALDLKKMDYLALDDRRQGGSEESDTSGDISGSTTEVDAIPALLQQYPEDASA
DYTTPLTEDELLDIGLQAAQLISDASDPLSTLKQLSQSFPKYASTIARRVTINEALEAEL
AIKNTRAPGGVNVAWLNGAPLTEPDMNPFSLLRLLRKERATMRTLAALGLNASQSLDLLT
HRAVGSAQGTPGVLDALFDASDRLEGSRATLWCNDFTSDARYARWATSLSTLRTVMMYPG
QLPSLRLNLFNVVMVLDLSQPNGLRFVANAVIPLISRGIPFRFGVVPSVETEDGLKMARL
VYWLFEHVGRDRTLSFITRVARLQFGGPLSPPILDWALIGSEFADVLAEHDLTASLTDII
SGVDDDVEESVTAARKYASRLAASRESGPHGHVFVNGRHFALDNEIIQNIQIVGTQMFQH
IQELVLSGVLTDDDAGRIDTYFYDLPTTASRRNPYIYPGDKTGELRIVNLPELLTNAHFP
GAHDAFVYPPGDAQVPFTTFVIADLDSEEGLTMVKEILAAMTENSAARVSFIHNPTSSAN
RALGSTSAVLGHLISRGQLAKLSPGELLNLLENLPFANAQTSEQAVLFGGSLLDELLDGV
SLAMLDDEPFVRASRFILRDLKLAPGAQVLVVNGRIVGPIAPGGIVAEDMEALYAFELRK
RVGPVVEALEDVVGLEQLARKDAAELVSRAAALLSSIHLPDPSEVGLFDAPIRPRRRNYR
LLGGEYTKFEFGDSTTAIFHLGVLIDPVSETAQKWSSLLEWLLNDPAVYVELHINPGRYK
ELPLKRFYRYNVQPSLRFSETGEEAKSIVTFKDLPEDPIYTLAMDIPPSWFVRPREASYD
LDNILLNGLAKHERTRGVYALFELDYFVIEGHAREGNTLSPPRGLQLQLVNGEGKAIADT
LVVANLGYLQFRAKPGVFGLEIRPGRGREIFTLESVGNEGWDSPTVDQAGNEITLMSFEG
LTLYPRMKRLPGMDFVDVLAPPKQQDSQDETIVEKLKHGITSLFGSKPEKQAEVAEPGST
QAEINIFTVASGLLYERFASIMILSVLRNTKSSVKFWFIENFLSPSFLEFIPHFAEAYNF
QYELVTYKWPSWLRQQKEKQRIIWAYKILFLDVLFPMDLKKVIFVDADQIVRADLKELVD
LDLHGAPYGYTPMGDDNKEMEGFRFWKTGYWKDYLQGLPYHISALYVVDLVRFRQMAAGD
ILRSHYQQLSADPNSLANLDQDLPNNLQREVPIFSLPEDWLWCETWCSKDRLHRAKTIDL
CQNPLTKEPKLARAKHIPEWEEYDAEIARFARQLADKGLIHSGMADADATVLADVGAGKA
VGLDQPGQDAEEEDTLRHRKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1264	1511	3.7e-128	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1264	1530	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	4.10e-179	1264	1511	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	1.05e-69	438	696	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	6.36e-61	32	237	1	185	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	2.51e-57	1110	1220	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV90671.1|GT24	0.0	1	1556	1	1556
QRV75871.1|GT24	0.0	19	1579	23	1579
CCA74280.1|GT24	0.0	18	1553	23	1546
QRW18757.1|GT24	0.0	11	1556	15	1492
QRW04776.1|GT24	0.0	255	1579	1	1345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	1.35e-293	17	1537	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	2.67e-293	17	1537	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	7.44e-293	17	1537	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.26e-259	19	1473	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	6.57e-240	17	1537	6	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.10e-237	18	1528	18	1422	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	8.54e-209	19	1542	27	1519	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	3.47e-208	1	1527	25	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	2.87e-206	13	1527	38	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9NYU1|UGGG2_HUMAN	4.64e-204	13	1537	26	1505	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999734	CS pos: 17-18. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in AGR57_8035T0-p1.