CAZyme Information: AGR57_720T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_720T0-p1
• CAZy Family: GH79
• CAZyme Description: Carbohydrate Esterase Family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		31935.97	5.1719

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC001:1496521-1497614(+)

Full Sequence      

MDRPWRYTSIVEQVGPGWPGVSGVKTLIVLGASYCDVGYDFKTSPRPSEDEPLGVPFPGS
TYAEHGHPNWVGHLVYRLRDRTRLVVYDFAKGGDTTEGVERQIEQEFLPNLADQPPPPDG
TRIWSANDTLFAIWVGINDCGYSGPDRIPPKLVKLFSLVDLLYSAGARHFMLIDIPPINR
SPAMRDPPRGKLSFEEWNDCLRARAADFARTHSDATVVIYSAWDTFTRVLNNPSAFGFNG
GDVRRRGGTIWVDHIHPSSQMHDEIAKDIAALLQNLPVPEEEPEVV

Enzyme Prediction     

No EC number prediction in AGR57_720T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	27	269	1.1e-38	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	7.18e-37	26	271	1	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	7.99e-10	102	242	103	262	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	8.46e-08	57	269	17	224	GDSL-like Lipase/Acylhydrolase.
238141	SGNH_hydrolase	1.80e-07	77	272	29	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.39e-04	59	263	11	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV83277.1|CE16	1.71e-57	9	275	15	274
QRV97477.1|CE16	7.41e-57	9	275	31	290
QRW11544.1|CE16	6.51e-52	9	277	17	276
QRV82804.1|CE16	6.51e-52	9	277	17	276
QRV96959.1|CE16	9.17e-52	9	277	17	276

PDB Hits     

AGR57_720T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	7.52e-31	25	270	32	294	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	1.05e-30	25	270	32	294	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AGR57_720T0-p1.