CAZyme Information: AGR57_6924T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_6924T0-p1
• CAZy Family: GH78
• CAZyme Description: Carbohydrate-Binding Module Family 1 / Glycoside Hydrolase Family 27 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501		53272.39	4.9468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC006:1771747-1773902(+)

Full Sequence      

MLARCFTLATLLAFACAQSQPWAQCGGIGWAGSTTCVAGWVCTYQNDYYSQCLQSSSSVP
STSPRTTSTPLSTPSSTRSSSSAPSTTSTRSSSSSSTSTTATLTGIAATAPTVGPSRDTG
KLPALGWNAWNAYGCGISSEIILAAAKDIVSLGLQAAGYEYVNIDDCWAEMKRDPTTQQI
VPDPNKFPDGIEGLATQIHALGLKVGIYSDAGTATCAGFPGSLGYENIDAATFNAWGIDY
LKYDNCNVPGNWSDTYPPPGNDWYNSNSAIRYRQMTAALAAQPRPVQFSLCIWGAANVWQ
WGSRVGHSWRMSGDSSASWSYITQILSTNAQYLDYVDFYSHNDMDMMEIGNGDLTIEEQR
THFAAWCFMKSPILLGTDLSKLNSTQLAIVTNPELLAFHQDATVGAPAKPFTPTAGTPAS
TNPPQYYAGASTKGTHVFMINTGNSMAIMSFTFSLVPGLTAGSGSYVVHDMWQGKDMGTF
SGSFSTSVAAHDTAAFLIAPA

Enzyme Prediction     

EC	3.2.1.22:58	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	219	478	1.3e-63	0.9912663755458515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	7.30e-118	123	401	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	9.00e-91	120	500	29	385	alpha-galactosidase
178295	PLN02692	4.44e-89	116	500	49	410	alpha-galactosidase
177874	PLN02229	2.87e-87	123	501	63	420	alpha-galactosidase
374582	Melibiase_2	2.56e-67	123	401	2	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA74446.1|CBM1|GH27	3.47e-194	17	501	17	490
CCA74935.1|CBM1|GH27	1.18e-189	4	501	4	459
QRV89573.1|CBM1|GH27	7.37e-182	10	498	13	442
QRW17738.1|GH27	8.01e-172	120	481	56	413
QRV74881.1|CBM1|GH27	3.50e-165	17	433	26	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SZN_A	2.30e-134	115	498	4	410	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]
1UAS_A	1.76e-80	120	500	6	361	Chain A, alpha-galactosidase [Oryza sativa]
3A5V_A	1.51e-78	123	491	9	383	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
6F4C_B	1.13e-74	116	500	2	362	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
4OGZ_A	1.88e-58	123	401	100	386	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94221|AGALB_PENSI	2.23e-130	104	498	3	431	Probable alpha-galactosidase B OS=Penicillium simplicissimum OX=69488 GN=agl1 PE=2 SV=1
sp|B0Y224|AGALB_ASPFC	2.14e-128	120	498	9	422	Probable alpha-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aglB PE=3 SV=1
sp|Q4WE86|AGALB_ASPFU	3.01e-128	118	498	28	443	Probable alpha-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aglB PE=3 SV=2
sp|A1D0A3|AGALB_NEOFI	1.71e-127	118	498	28	443	Probable alpha-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglB PE=3 SV=1
sp|B8N306|AGALB_ASPFN	4.11e-127	120	498	27	438	Probable alpha-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000323	0.999655	CS pos: 19-20. Pr: 0.6225

TMHMM  Annotations     

There is no transmembrane helices in AGR57_6924T0-p1.