CAZyme Information: AGR57_6579T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_6579T0-p1
• CAZy Family: GH71
• CAZyme Description: Carbohydrate Esterase Family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		35352.83	5.2692

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC006:944120-945299(-)

Full Sequence      

MFKPVSVAVLALGAVSSFALEFPFLKGPLPGQIKNLVTFGDSYTDVVVTGDNGISWPIYA
AQDGNLKLFPFARAGATCSNNITFRPFPSLFESQLPLFFAEKQNGTLHLNPEETIYTLWI
GTNDVGVNSLIVGQGAPGATVVDTTTCAVNWVKTLYKNGARNFLFQNMIPLEKTILYSAD
SYPNRYWTAQRNTTEWSVFMTELTHAGNALSKALLELLAPTLPGAHIGYFDSHTFFEDML
ANPHKFLNGTVPPNTTGAIHSCVFGLNQDTSDTGNCTTVTGAAADSYFWYDELHPSEQTD
RNVGKAIAAAIRRTSDQYTTWFS

Enzyme Prediction     

No EC number prediction in AGR57_6579T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	38	307	1.3e-38	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.18e-34	35	310	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	8.03e-19	39	307	6	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	9.11e-08	34	296	2	266	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	1.57e-05	36	307	1	224	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	9.51e-05	116	311	165	333	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO98374.1|CE16	1.04e-132	56	323	2	270
CCA71582.1|CE0	2.85e-94	9	323	6	326
QRW13529.1|CE16	1.53e-76	31	321	25	328
QRV98980.1|CE16	2.16e-76	31	322	25	329
VWO97463.1|CE16	1.08e-70	168	323	1	156

PDB Hits     

AGR57_6579T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	8.31e-32	32	321	26	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000286	0.999689	CS pos: 19-20. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in AGR57_6579T0-p1.