CAZyme Information: AGR57_6371T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_6371T0-p1
• CAZy Family: GH55
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	PchrRP-78_SC006|CGC6	65046.13	7.2333

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC006:506768-508845(+)

Full Sequence      

MWPFSTPYPTYAPKDLNAEYDYIIVGGGTGGCVLARRLSEDLNCSVLVIERGDARDNWLD
RFPLLSTHHWGDRKHSMVLQADMLGQKTDIITGKGLGGTSRINAMQYSRGAPGEYNAWAR
AGRKGWSYEELLPYFERAEGLYNPETHGHYGTEGPWKIQAPTNAFKFGINQHLFQACKKA
GFSYGKDVSDPKLPTSGCFLIHHTIEPSGTRHSTFRAYLPKSYAVAHRKNLHLCVNTIAR
KIETEKLSDGNLRATGVLIQSTMPGAQTVSVQARREVIMCSGALRTPQVLMLSGIGPETH
LREMNIPVVHNLEGVGSNLQDHMGTHMDMQCPLQDSLYLLVRRPWYLLYQLLRYFIFGDG
WFLTSLVEVCILTCARWLDADGKQKPLTAEDQDPTRPENVPDIEIMSSPIVDPRFPGYDH
SRGGFTLLAAPLRPFSRGTLRLQSSDPREEPAVTLNYLSDPRDRTILRAAVRLCLRVLRE
IEATSYPVARWRAPRSDDDAALDTFIAEQSWSFLHYSSTCRMAPADDPEPGVVDDELRVH
GISNLRIADASVFPQIPAAHLQAPVVVVAEKCADMVKAAWKA

Enzyme Prediction     

No EC number prediction in AGR57_6371T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	19	578	1.2e-148	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.54e-114	19	577	5	532	choline dehydrogenase; Validated
225186	BetA	2.90e-105	13	579	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.43e-43	434	572	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.26e-35	85	323	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.35e-33	4	568	40	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO94942.1|AA3_2	3.95e-127	9	577	15	584
ATZ51574.1|AA3_2	2.81e-125	2	578	3	600
VWO94148.1|AA3_2	5.83e-121	9	578	20	586
QYS92880.1|AA3_2	6.94e-113	1	581	1	616
VWO96598.1|AA3_2	4.91e-107	6	577	2	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.86e-60	19	575	7	559	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.86e-60	19	575	7	559	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.86e-60	19	575	7	559	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	1.86e-60	19	575	7	559	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	2.52e-60	19	575	23	575	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1QXE1|BETA1_CHRSD	3.18e-76	19	577	6	536	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|A4XPI5|BETA_PSEMY	5.01e-76	16	577	1	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=betA PE=3 SV=1
sp|A4JJG6|BETA_BURVG	2.75e-75	19	577	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	3.84e-75	19	577	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q0B711|BETA_BURCM	1.47e-74	19	577	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000014

TMHMM  Annotations     

There is no transmembrane helices in AGR57_6371T0-p1.