CAZyme Information: AGR57_5654T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_5654T0-p1
• CAZy Family: GH5
• CAZyme Description: Glycosyltransferase Family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		71793.15	8.2302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC005:1173596-1175816(+)

Full Sequence      

MHDGSPGSKRSFLYVAAVLLIFMQAGFWSARKKTQEVFPDNSLVPKPPSFLSLIKGQSKT
VINEHPIPKLMAEAELQFRERLSRQSKTLPQAVAEYKKRFKRDPPRGFDDWWKFVQDNGV
LMIDEYNAIAEDLEPFWDLSPEEFRQRASLAGHLPSIDLVKIRSGAGQAVNIKEGFDNPD
GVSARAKGFLLMIEKFQDKLPDMDLPINAMAEGRILVPWEYRKYPNLTDGALAEQLSGKY
SPDWRGEGNVWEAFRRTCEPGSPARHLFSSTRASSTTQVRLSQLESNSDEVTFARNVQGN
FSFCQHPWAHYSQGHFFSDWRTIPVLFPIFSPAKASGFLDIRVPSHYYHGQTRRYTYGWD
PVNLELHSVDHMETPWEMKSDKIFWRGASTGGGSSPPGFAGQYQRHRLVRMATDQSTTNR
TILFADPPGSKTYVFTDVPTAALNKEVMDVAFVKLVDTFNFPGGIDALLRDYRFDESGVS
LGDHWKYKYLVDVDGMGYSGRFFSFLESDSAVLKATVYREFFEEWIQPWLHYIPLSPTYH
EIYNVHAFFSGGTESTLRAANSTALELPPTQRKSVDGDRRLRRIARAGKQWKRTLGRRVD
MEAYVYRLCLEYARLWSDDRDSMNFTL

Enzyme Prediction     

No EC number prediction in AGR57_5654T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	307	615	1.1e-64	0.968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.25e-39	303	563	17	225	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	7.21e-08	328	538	108	268	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA73884.1|GT90	2.19e-242	9	625	22	656
AAW46283.1|GT90	4.72e-242	55	625	57	638
AAD44757.1|GT90	4.72e-242	55	625	57	638
ADV25019.1|GT90	1.91e-241	55	625	57	638
KGB77320.1|GT90	3.83e-241	55	625	57	638

PDB Hits     

AGR57_5654T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	8.73e-40	65	622	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	1.04e-07	328	615	251	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	9.68e-07	328	615	252	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.928162	0.071860

TMHMM  Annotations     

Start	End
12	29