CAZyme Information: AGR57_5611T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_5611T0-p1
• CAZy Family: GH5
• CAZyme Description: Chondroitin AC/alginate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	PchrRP-78_SC005|CGC2	54073.92	5.1972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC005:1100568-1102690(-)

Full Sequence      

MKHRSSLLCLAVAALGAVPAVHSLTDYANVFISPQDILNNTYPNLGPANKTIQDWAASSI
QGGPWLCSHLSPHQAVIKKPFPPPSGDNHDYMSWAPYWWPDCSNVHNTTALSPQEVWQQC
NYVQKDGKLNQGNRIVNNIGDFETMADAILYNSLAYGLTRVDEFTNRVVLYINTWFISPD
TRMNPNLNYAQMEGGPTGQVGTHTGILDLKCMTKIVSAILLLREAKAPLWTADIDAAFTS
WAKEYIQWLTTAEIALEERKALNNHGSFYFNQLASLQILVGDTDGAKSTIEEYFNGIYMG
QIAANGDQPLESARTRPYHYRAYNLAAMITNARLGEYVGVVAWNKTTNAGATIQDALDYA
MTIPPGAVEANYVAELYPPVAAVAAVYGDAGGKYSGFLAKAEGAAYVADACFFWSQPLSD
SGYAAQLASGSATVTWGAPYSVPTSYHIATDVPTPSATPKGGDGAKQDNAASARGAWRAY
GMLYGACAVVMVASFMEFL

Enzyme Prediction     

No EC number prediction in AGR57_5611T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	76	362	7.7e-86	0.967741935483871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	8.12e-61	78	361	5	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW24462.1|PL38	2.54e-149	10	435	8	427
QRV83646.1|PL38	5.74e-145	4	422	2	413
QRW05956.1|PL38	3.27e-144	4	422	2	413
QRW12314.1|PL38	3.27e-144	4	422	2	413
QRW19906.1|PL38	4.54e-142	10	422	8	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	2.79e-39	43	359	24	316	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

AGR57_5611T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999744	CS pos: 23-24. Pr: 0.9632

TMHMM  Annotations     

There is no transmembrane helices in AGR57_5611T0-p1.