CAZyme Information: AGR57_5500T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_5500T0-p1
• CAZy Family: GH47
• CAZyme Description: Glycosyltransferase Family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	PchrRP-78_SC005|CGC1	32191.09	9.1862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC005:863244-864110(+)

Full Sequence      

MHSDNAVVTTLYTDAYAPAVATLGHSLRKVDTSARLIMLYIPSQVSASALCLAASSGFVP
HPVARIPPPANGSGIEPRFADQYTKLTLWTLDALPEPVRALVYVDADALVLRNFDELFAA
PWAFAAVPDVYTDARGFTTSFNAGVMLVRPDSALFAAMRAALPAARFPRRMAEQAFLNQF
FATDALRLPYAYNGNLALKERAPAVWHGIRTEMRIIHYTLIKPFVSKHWGAVPLDRMQRR
VDEAARAKGGMFREEMLLWGRMWEETRTVYAQRLDECRGLKNFGSYDF

Enzyme Prediction     

EC	2.4.1.186:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	3	225	8.6e-26	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.80e-43	5	223	1	211	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133037	GT8_A4GalT_like	1.12e-08	77	223	73	245	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
215090	PLN00176	5.49e-08	3	203	21	245	galactinol synthase
224359	RfaJ	4.15e-07	77	229	75	249	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	1.94e-06	83	151	84	163	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA68772.1|GT8	1.52e-33	3	265	54	298
QFQ85943.1|GT8	1.68e-18	3	224	14	242
ADZ70219.1|GT8	2.25e-18	3	228	14	248
QFT31772.1|GT8	2.32e-18	6	228	16	247
ASP33127.1|GT8	2.46e-18	3	228	13	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	3.04e-19	6	219	9	233	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3V90_A	2.66e-10	3	218	22	233	Structure of T82M glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus],3V91_A Structure of T82M glycogenin mutant truncated at residue 270 complexed with UDP-glucose [Oryctolagus cuniculus]
1ZCT_A	3.57e-10	3	218	22	233	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V8Y_A	3.60e-10	3	218	22	233	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]
3RMV_A	3.94e-10	3	224	3	221	Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP [Homo sapiens],3RMW_A Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP-glucose [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13280|GLYG_RABIT	2.31e-09	3	218	2	213	Glycogenin-1 OS=Oryctolagus cuniculus OX=9986 GN=GYG1 PE=1 SV=3
sp|P46976|GLYG_HUMAN	3.31e-09	3	286	2	273	Glycogenin-1 OS=Homo sapiens OX=9606 GN=GYG1 PE=1 SV=4
sp|Q8GWB7|GUX6_ARATH	6.12e-09	6	224	32	257	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
sp|H2KYQ5|GYG1_CAEEL	9.64e-09	6	224	4	219	Glycogenin-1 OS=Caenorhabditis elegans OX=6239 GN=gyg-1 PE=1 SV=1
sp|Q9R062|GLYG_MOUSE	1.37e-08	3	218	2	213	Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000040

TMHMM  Annotations     

There is no transmembrane helices in AGR57_5500T0-p1.