CAZyme Information: AGR57_4281T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_4281T0-p1
• CAZy Family: GH3
• CAZyme Description: Carbohydrate-Binding Module Family 1 / Glycoside Hydrolase Family 10 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		43486.79	5.0734

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC004:581445-582946(-)

Full Sequence      

MMKLSASFAALALLLPFVQAQSPVWGQCGGIGWTGPTTCTAGNVCQEYSAYYSQCIPAAT
SVTSVSTAPNPPPTSHTSTSSAPSGASTSTAKLNTLAKAKGKLYFGTATDNGELSDTAYT
AILDDNTMFGQITPANSMKWDATEPQQGQFTFSGGDQIANLAKSNGMLLRGHNCVWYNQL
PSWVSNGKFTAAQLTSIIQNHCSTLVTHYKGQVYAWDVVNEPFNDDGSWRTDVFYNTLGT
SYVQIALEAARAADPDAKLYINEYNIEYAGAKATSLLNLVKTLKAASVPLDGIGFQSHFI
VGQVPTGLQSQLTTFAAQGVEVAITELDIRMTLPSTPALLAQQKTDYSNVIKACASVEAC
VGVTVWDWTDKYSWVPNTFSGQGAACPWDQNFVRKPAYDGIAIGFGN

Enzyme Prediction     

No EC number prediction in AGR57_4281T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	93	401	3.6e-102	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	4.60e-168	93	402	1	309	Glycosyl hydrolase family 10.
214750	Glyco_10	2.09e-128	138	401	1	263	Glycosyl hydrolase family 10.
226217	XynA	1.16e-87	129	402	58	338	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
197593	fCBD	2.09e-12	23	56	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	9.91e-12	25	52	2	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABZ88797.1|CBM1|GH10|3.2.1.8	2.69e-294	2	407	1	408
AEK97220.1|CBM1|GH10|3.2.1.8	2.69e-294	2	407	1	408
AAG44993.1|CBM1|GH10|3.2.1.8	2.69e-294	2	407	1	408
AAG44992.1|CBM1|GH10|3.2.1.8	7.72e-294	2	407	1	408
AEK97221.1|CBM1|GH10|3.2.1.8	1.49e-243	1	405	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.72e-141	91	406	1	318	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.58e-133	89	406	21	340	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	1.76e-122	90	402	2	309	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	2.87e-121	90	402	2	309	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3CUF_A	5.09e-99	105	406	15	313	Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine [Cellulomonas fimi],3CUG_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotetraose-like isofagomine [Cellulomonas fimi],3CUH_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotriose-like isofagomine [Cellulomonas fimi],3CUI_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylotetraose [Cellulomonas fimi],3CUJ_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylopentaose. [Cellulomonas fimi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HEZ1|XYNA_PHACH	4.78e-295	2	407	1	408	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	2.17e-243	1	405	1	397	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|O60206|XLNA_AGABI	2.80e-150	88	405	14	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	4.51e-135	91	404	19	333	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	7.42e-119	86	402	36	347	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999768	CS pos: 20-21. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in AGR57_4281T0-p1.