CAZyme Information: AGR57_387T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_387T0-p1
• CAZy Family: GH27
• CAZyme Description: Glycosyltransferase Family 58 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		47644.68	9.0447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC001:810062-811586(-)

Full Sequence      

MSSSSPSLASIRSSGDLLQYFKCLLTDSRYFLTLAGLVVLGDAVLTQLIIRFIPYTEIDW
ETYMYQLELYLKGERDYSLISGPTGPLVYPAGHVYIHKVLHSLTESGTNLKTAQQIYGLL
YIAMLTTTCAIYYKAGNVSNWVLMLLPLSKRLHSIYALRLFNDCWEVLGSQAAVLAFASG
YDSLGIMLFSAAVSVKMSALLYLPGILVVLVRRRGLLHTVGALGLLAFSQIALGWPFIQE
YPRSYVSNAFEFSRQFLYKWTVNWRFVSEETFLSTAWARTLLVCHLMTLVIFGFAWCRRD
GGALEVVKRTLRRPMSPPGLVPTTADYVVTVLFTSNLVGILFARSLHYQFYSWYAQQIPF
LLWRTRYPAPLKLALLFGVEYAWNVYPSTTVSSAVLCGANLLLVIGVFFGYPEGKDVPSH
NSDS

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	37	393	3.4e-135	0.9917582417582418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	37	393	2	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW13371.1|GT58	8.11e-149	15	424	16	427
QRV98819.1|GT58	1.87e-147	15	424	16	427
QRV84772.1|GT58	1.87e-147	15	424	16	427
CCA69403.1|GT58	3.25e-147	22	414	7	407
QRW25746.1|GT58	7.25e-144	41	416	6	383

PDB Hits     

AGR57_387T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O82244|ALG3_ARATH	2.69e-103	39	408	40	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q55F69|ALG3_DICDI	1.10e-98	29	409	16	423	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|P0CN92|ALG3_CRYNJ	1.01e-96	22	424	26	444	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ALG3 PE=3 SV=1
sp|P0CN93|ALG3_CRYNB	1.01e-96	22	424	26	444	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ALG3 PE=3 SV=1
sp|Q9C1K8|ALG3_NEUCR	2.73e-92	40	413	42	424	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000004

TMHMM  Annotations     

Start	End
31	53
116	138
187	209
216	238
275	297
318	340
389	411