CAZyme Information: AGR57_3760T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_3760T0-p1
• CAZy Family: GH20
• CAZyme Description: Glycosyltransferase Family 66 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	PchrRP-78_SC003|CGC8	85613.22	8.7939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC003:1833327-1836217(-)

Full Sequence      

MATKAYILPTNVPPETVNNLRSLVRIVCLALISAAAISSRLFAVVNFESIIHEFDPWFNY
RATRLLAAKGFYAFWNWFDPTAWYPLGRVVGGTIYPGLMATSGVIYNVLHALHLPVDIRN
ICVLLAPGFSALTAWATYMFTKEMKDESAGLLAAAFIGIVPGYISRSVAGSYDNEAIAIF
LLMFTFFCWIKALKTGSAFFGTLAALFYFYMVAAWGGYAFITNMIPLHALAFILMGRFSS
RLYVAYSSWYAIGTLASMQVPFVGFQPVRTSEHMAALGVFGLLQIIAFAELVRSHVSSKQ
FQSLLYASVVAMGLLGFVGIVGLTYKGWIAPWTGRFYSLWDTGYAKKYIPIIASVSEHQP
TAWPSFFMDLHILVFLFPAGVVMCFSKLRDEHIFVILYSVVASYFAGVMVRLMLTLTPVV
CVAAAIAVSSLLDTYIDPTVPVPEEDQPAETEATPQDPTKKAKKAAPAANPTSFGEYLSR
FTGNTNKPRGIFGVNNRLIVLFNTFGMLIFFVVHCTWVTSNAYSSPSVVLASTGADGSAH
IIDDFREAYYWLRQNTPEDAVVMSWWDYGYQIAGMANRTTLVDNNTWNNTHIATVGKAMS
STEEVAYPILKKHDVDYVLIIFGGLLGYSGDDINKFLWMVRIAQGVWPDEIQEPNYFTKQ
GEYRVDDRASETMKNSLMYKMSYYRFNDLFGGQPAVDRVRGQQMPKQGPTLDYLEEAFTS
ENWIVRIYQVRKEDLLGRDLKVANAFEQGRKRKKTKPPVRRRALA

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	26	687	7e-193	0.847041847041847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	4.87e-137	26	524	4	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	7.31e-104	23	761	18	760	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	1.84e-25	53	578	32	546	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW02713.1|GT66	0.0	5	764	4	750
QRV73765.1|GT66	0.0	5	764	4	750
CCA70753.1|GT66	0.0	9	764	7	753
QRV88573.1|GT66	0.0	5	764	4	749
QRW16703.1|GT66	0.0	5	763	4	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	1.10e-318	21	764	13	714	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	2.91e-294	21	734	69	776	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	1.19e-270	22	737	16	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	2.46e-270	22	731	16	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	3.37e-270	22	737	16	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	0.0	25	757	25	742	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	5.66e-318	21	764	13	714	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q3TDQ1|STT3B_MOUSE	8.28e-295	21	744	66	786	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|E2RG47|STT3B_CANLF	1.85e-294	21	734	69	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	1.50e-293	21	734	69	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000002

TMHMM  Annotations     

Start	End
22	44
87	109
121	140
150	169
176	193
199	221
242	264
274	296
303	325
367	386
393	410
414	432
498	520