CAZyme Information: AGR57_3604T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_3604T0-p1
• CAZy Family: GH18|CBM5
• CAZyme Description: Glycosyltransferase Family 39 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	PchrRP-78_SC003|CGC2	88142.54	8.1200

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC003:1512247-1515055(+)

Full Sequence      

MSGPQDVGIRQRARGGPGARSPQPLSPNSEADDEHHAAFRTRDREGFSIEKLLETQEASV
ALVATLTLLAFALRFYKINHPDQVVFDEVHFGKFAAHYISREYYFDVHPPLTKLLFGLAG
WFVGFDGKFKFENIGDSYTENHVPYVGMRALPALFGSLTVPVVYAIMKESGYSNIIAAFS
ACLILFDNAHVAQSRLILLDAPLIFFMSMTIYSYIRFRKLRYLEFSPAWWGWLLATGFFM
ACTWSSKVNGILTVAAIGIAVLIDLWDLLDHRKGHSMEYFWKHFTARAIGLIVLPVFLYL
FFFWIHLSVLTYSGPGDAFMSPAFQETLRDNELLLNSQEIRYYDTITIRHKDTKVWLHSH
PERYPLKYEDGRISSQGQQVTGYAHDDINNYWQVIPTKALPETGRGRIVRHEDVIQLLHV
STQTLLMTHDVASPTMPTNEEFTTWPKDDHSRYNDTLFHLRLMDVNPGAAWKTKSGHFKL
IHVPTKVAMWTFPGQLPEWAFNQQEVNGKKEVSDKTTIWYPDEIVDTEDGEIRTKEELGH
KEPKKMNFFKKFGELQLLMLQHNAGLVASHPYASGPFNWPFLISGISFWTQSEGQKQIYL
IGNLIGWLAATFGVAIFVGIIGADLLARRRGIEPIPPPVRNRLWNSTGFFLLIWAVHYFP
FYLMGRQLFLHHYLPSHLASALVAGAVLHFVLSETINYPISIRGPSTRPQPAQKADVGMK
GPIVVGVFALAMLGLFVYISPLTYGTPGLTGEQVNARRLLNTWTLHFAAKKTDHAI

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	66	307	3.3e-71	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	62	767	26	697	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	8.53e-78	64	311	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.09e-73	550	761	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	2.75e-10	352	521	7	185	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
404170	PMT_2	1.73e-08	146	296	22	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96990.1|GT39	0.0	9	775	9	772
QRW16888.1|GT39	0.0	6	770	3	775
QRW02771.1|GT39	0.0	54	770	58	775
QRV73816.1|GT39	0.0	54	770	58	775
QRV88619.1|GT39	0.0	54	753	58	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	3.60e-96	62	763	52	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.64e-88	42	765	43	753	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	2.38e-217	12	767	6	753	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	1.30e-214	51	767	51	774	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	1.59e-211	45	757	38	751	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	1.12e-110	52	765	31	742	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
sp|Q8R2R1|POMT1_MOUSE	2.13e-110	52	765	31	742	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995196	0.004799

TMHMM  Annotations     

Start	End
103	125
145	167
172	191
196	215
228	245
250	269
290	312
605	627
648	670
680	702
723	745