CAZyme Information: AGR57_2889T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_2889T0-p1
• CAZy Family: GH18
• CAZyme Description: Glycoside Hydrolase Family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806	PchrRP-78_SC002|CGC8	86848.13	4.4659

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:2979183-2982380(-)

Full Sequence      

MHGLAGLGLGFALLLYIEALSLCSASHLEVRGDLHFPLHARGTNKDGSVPVYKNADASIE
DRIADLLPRMTLEEKVSQLIQGDINGWMNMTDPLDNTLVFNATGLEEMMAQKAGAIWAGY
LAPWEKIVFAITVGQRYLMENTTLGIPAIFQTEGLHGFTDNGTIWPSPIGLAASFNPALL
QRAAATIADEAEGLGYSQAFAPVLDLSRELRWGRVEENFGEDPFLTGEMGAAYVTGLQSG
RRRNASSTAIARMAATCKHFAAFGSPQGGLNIAQVSGGERELRTMFLKPFNRACVDSLSI
MTAYSSYDGIPAIANAHLLTDILRNEWGYKYFVTSDAGSVDLLITTHGTCGDRECAARAA
VENYSGEMGGGTYTYLTLPDQVRAGNISAEYIDDTVKTVLRTKFSLGLFENPYPYDDYLD
TLRTSQTRELLHQMEQETIVLLENRNNVLPLKSNLNSIALIGPQVDRVSFGDYVFFNASL
NGISPLAGFTQLLSNSSTQINFAEGCKLWSNDESSFAEAVAAARASEVAIVMVGTWSLDQ
TLLWTPGTNATTGEHVDLSDLGLVGAQLKLVQAVQATGVPTVVVLVSGKPVAEPWIQANA
DAVIQQFYPGELGGLALAEVVFGEVNPSGKLPVSFPRSVGTTPVFYNYIKGSRPLDPGME
LDDGTLLFGHQYVLDSPVPLWSFGHGLSYTTFNYTDLTLSKSTIGTGEDFSVSVTVHNTG
PLDGKEVVQVYATDLVSSVATPNQELVGFQKVDIPAGSSQTVTIPVKSEQLAVWTVKNTW
AVEPGQFLIKVGTSDQTFLSTTLNVA

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	140	358	2e-59	0.9351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.62e-143	54	796	26	755	beta-glucosidase BglX.
224389	BglX	1.64e-73	70	488	1	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.47e-69	144	766	79	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.51e-55	71	401	1	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	4.86e-48	439	689	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV86385.1|GH3	0.0	50	805	32	791
QRW00437.1|GH3	0.0	50	805	18	777
QRW14954.1|GH3	0.0	50	805	32	791
QRW27037.1|GH3	0.0	50	805	58	803
CCA66712.1|GH3	9.88e-309	87	805	31	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.60e-244	50	796	5	746	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.90e-243	50	796	5	746	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.23e-109	52	805	36	784	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	5.01e-104	61	805	10	750	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.94e-100	63	792	7	719	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	1.56e-107	63	792	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	5.97e-107	63	793	38	752	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	9.81e-106	52	805	29	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|T2KMH0|PLH24_FORAG	1.83e-103	54	796	28	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q23892|GLUA_DICDI	5.19e-83	58	792	74	812	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999782	CS pos: 25-26. Pr: 0.9144

TMHMM  Annotations     

There is no transmembrane helices in AGR57_2889T0-p1.