CAZyme Information: AGR57_2535T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_2535T0-p1
• CAZy Family: GH16
• CAZyme Description: Glycoside Hydrolase Family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		53015.66	4.3100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:2119761-2121424(+)

Full Sequence      

MAYYPSYTAASFPPERVDFTRYDWVDFAFAVPQAGGGLGWDGADGSAGDVLRRLVARAHA
AGKHVKVSVGGWTGSARFSGAVAGADGRGALVDAIVRLYGAYALDGIDIDWEYPGQPGAD
GNAYAPQDTANFLAFLRLLRQRLPPQAKISAAAMTVPWADAHGAPLADASAFAQVLDWIL
IMNYDTWGSASPPGPNAPLSNACHNSTQASASAVAGIAAWTAAGFPASKIVLGVPSYGYI
SHSSADGLQTRSVRRRRHVPMHLDGGAGAPGTAGAASTAGAEGTVSAEGTDGAGSAGVPV
VLNEDGNAADGEVQFRDLVQQGVLQYVAAWDADAAAVRDAQADGADGASGDGADGDTADD
PGGDSSADDDSSSDGSDGATPGGSGGSGGPGGSGGPGGSGGSSAGAGPDGSGDADSSADD
GVSGTRGVLPAGLPLPARSSTADTLSFAGHTIANVFTGLRGFERRWDACSSTPFLRSARA
GQVVAYDDPQSLELKAALARYAGLRGVNMFDAHGDTDAGDLVDAIRRGLGL

Enzyme Prediction     

No EC number prediction in AGR57_2535T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	2	279	2.1e-42	0.6891891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.79e-42	2	239	4	238	Glyco_18 domain.
119365	GH18_chitinase	1.05e-41	1	238	2	263	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	1.18e-37	1	239	3	225	Glycosyl hydrolases family 18.
225862	ChiA	8.99e-27	2	238	42	314	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119349	GH18_chitinase-like	1.03e-26	1	185	2	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV73087.1|GH18	1.21e-107	3	531	127	506
QRW02133.1|GH18	4.61e-107	3	531	161	540
QRV87962.1|GH18	2.67e-106	3	531	127	506
KGB76962.3|GH18	1.29e-93	1	531	454	831
ADV24093.1|GH18	4.74e-93	1	531	452	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	2.52e-27	14	241	14	239	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6KST_A	3.95e-23	1	247	10	267	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	1.32e-22	1	247	10	267	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	1.78e-22	1	247	10	267	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1ITX_A	1.45e-19	67	238	127	307	Chain A, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	2.01e-18	67	238	159	339	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	3.16e-14	67	238	94	268	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|O81862|CHIC_ARATH	8.51e-12	88	239	116	261	Class V chitinase OS=Arabidopsis thaliana OX=3702 GN=ChiC PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	2.84e-11	67	272	94	286	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|Q11174|CHIT_CAEEL	5.00e-11	47	238	111	303	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AGR57_2535T0-p1.