CAZyme Information: AGR57_2327T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_2327T0-p1
• CAZy Family: GH16
• CAZyme Description: Glycoside Hydrolase Family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852		92865.13	5.8715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:1681000-1684486(+)

Full Sequence      

MSVASTRFSADDLLEKLSLGQKIALLTGYGLWHTTPIPDVDIPPIRMSDGPNGVRGTRFF
NGIPSNCFPCGTGLGSTFDVGLAEEIGKALGDECHAKGCHILLGPTINTHRSPLGGRGFE
SFSEDPHLNGHIAAAYVKGLQSKGVSATLKHFVANEQEFQSHSSSSDVSERALREIYLKP
FQIAVKYAKPWAVMSAYNRLNGIHCSENEWLLNDVLRKEWGYEGMVMSDWTGTYSTTESI
KAGVDLEMPGPTVMRGGAVFRAIQAEKLFPHDIDIRVRKILRMLQHARDSAIPFNAPEEI
LDTPAVRRLLRKASASAIVLLKNEKGILPIEHSVRKIAVIGPNARQAVISGGGSASLRPT
YTVSPLEGITAAAQEIGAQVEYALGTLSVKRLPVMDAFVSYDGSPGGLLEFWNESPTSDW
LSTSPDFSNPTQDVAWSTRTESTMCFLVDGVDDNSVNDVCWIRFSTTFTPDEDGDWQLEM
SLGGRGNLFIDQKLVLELSVDPPQGESFLGLGTVEVRAVLPGLKAGTEYELEIRISNEEF
VARGASPGMRGGFQLGGIHVVDPERALRQAVHLAKTSDIVVLVVGLNNDWETEGADRATM
SLPGLTDRLVSEVLDANSQTVVISQSGTPVTMPWIHRAHTVLQAFYGGNEVGNGMADVLF
GKVNPSGKLSLTFPKRIEDNPSYTSFGNTAQVHGHVLYNEGIYVGYRGYEVKKLEPLFPF
GHGLSYTTFEYSDLEISEISEHGKFSVQFKVKNSGNVEGSEVAQVYIADPEASLPRPVKE
LKGFAKTVALRPGQSERCTVHLDKYALSFYDERRGAWVAEAGKFEVLVGASSADVKLSGH
VKLRKSFHWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	38	249	6e-70	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.20e-86	68	836	120	758	beta-glucosidase BglX.
224389	BglX	2.46e-70	42	379	60	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.42e-54	318	706	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.21e-39	55	283	78	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	8.82e-35	10	803	53	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL27551.1|GH3	0.0	11	852	8	847
CDZ97665.1|GH3	2.08e-306	11	852	7	837
CDR42254.1|GH3	5.06e-280	8	852	9	851
QRW26513.1|GH3	5.04e-261	11	849	12	858
UJO24157.1|GH3	5.67e-259	8	852	6	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.06e-224	6	852	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.06e-218	6	852	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.19e-152	13	847	8	678	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	2.79e-122	11	839	5	709	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.18e-121	11	839	5	709	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	3.41e-256	7	852	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.41e-256	7	852	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.94e-255	7	852	3	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.56e-254	7	852	3	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.18e-251	7	852	3	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000008

TMHMM  Annotations     

There is no transmembrane helices in AGR57_2327T0-p1.